KEGG   Polymorphum gilvum: SL003B_2183Help
Entry
SL003B_2183       CDS       T01458                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pgv  Polymorphum gilvum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SL003B_2183 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SL003B_2183 (trpC)
Enzymes [BR:pgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SL003B_2183 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2304354..2305184)
Genome map
AA seq 276 aa AA seqDB search
MADILQKIEAYKRAEIAAAKAAVPLAELAARIADAGPPRGFLRAIEAKLAAGAYALIAEI
KKASPSRGLIRADFDPPALARAYQAGGAACLSVLTDTPSFQGRPEYLGAARAAVSLPALR
KDFLYDTYQVHEARAWGADCILIILAGVDDATAKALEDTAFELGMDVLLEVHDEAELERA
LRLSSRLVGINNRNLKTFETRLETSERLAPMVPADRIVVGESGLFTPADLARMNAVGIST
FLIGESLMRQDDVEAATRALLARPQSATGAAAMTAG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcctgcagaagatcgaggcctacaagcgcgcggagatcgccgcggccaag
gccgccgtgccgctggccgagcttgccgcccgcatcgccgacgccgggccgccgcgcggt
ttcctgcgcgccatcgaggcgaaactcgccgccggcgcctatgccctcatcgccgagatc
aagaaggcgagcccgtcccgcggcctgattcgcgccgacttcgacccgccggccctcgcc
cgcgcctaccaggccggcggcgccgcctgcctgtcggtgctgaccgacacgccgtcgttc
cagggccggccggaatacctcggcgccgcgcgcgccgccgtctccctgccggccctgcgc
aaggactttctctacgacacctaccaggtccacgaggcgcgcgcctggggcgccgactgc
atcctgatcatcctcgccggcgtcgacgacgccacggcgaaggcgctcgaggacaccgcc
ttcgaactcggcatggacgtgctgctcgaggtccacgacgaggccgagctggagcgcgcg
ctgcgcctgtcgtcgcgcctcgtcggcatcaacaaccgcaacctgaagaccttcgagacc
cggctggaaacgagcgaacggctcgccccgatggtgccggccgaccgcatcgtcgtcggc
gaatcgggcctgttcacgcccgccgaccttgcccgcatgaacgccgtcggcatctccacc
ttcctgatcggcgaaagcctgatgcgccaggacgacgtcgaggctgccacccgcgcgctg
ctggcgcgtcctcagtccgcgaccggcgccgcggcgatgacggcgggatga

DBGET integrated database retrieval system