KEGG   Polymorphum gilvum: SL003B_2186Help
Entry
SL003B_2186       CDS       T01458                                 

Gene name
tpiA
Definition
Triosephosphate isomerase 1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_2186 (tpiA)
   01230 Biosynthesis of amino acids
    SL003B_2186 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_2186 (tpiA)
   00051 Fructose and mannose metabolism
    SL003B_2186 (tpiA)
   00562 Inositol phosphate metabolism
    SL003B_2186 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SL003B_2186 (tpiA)
Enzymes [BR:pgv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SL003B_2186 (tpiA)
Exosome [BR:pgv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SL003B_2186 (tpiA)
  Exosomal proteins of bladder cancer cells
   SL003B_2186 (tpiA)
  Exosomal proteins of melanoma cells
   SL003B_2186 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2308377..2309135
Genome map
AA seq 252 aa AA seqDB search
MTATIRPLVAGNWKMNGLGASVAEFAAIAGGIDAALATRVDTMICPPATLVARLAEAAAG
TAVAVGGQDCHAAASGAHTGDVSAEMLADAGASAVIVGHSERRTDHNESDALVRAKAQAA
WRAGLTAIVCVGETEAQRRAGETLAVVGAQVAGSVPDGARAATCVVAYEPVWAIGTGLTP
TAADVAEVHGAIRAALTARFGAEGAAMRLLYGGSVKPANAAELMAVADVNGALVGGASLK
AADFLGILAAYR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgacgatcaggccgctggtggccggcaactggaagatgaacggcctcggcgcc
agcgtggcggagttcgccgcgatcgcgggcggcatcgacgccgccctggcgacccgggtc
gacaccatgatctgcccgccggcgacgctggtggcgcggctggccgaggcggccgccggc
acggcggtcgcggtcggcggccaggactgccacgcggcggcctcgggcgcccatacgggc
gacgtctctgccgagatgctggccgatgccggtgccagcgcggtgatcgtcggtcattcg
gagcggcgcaccgaccataacgagagcgacgccctggtgcgggcgaaggcgcaggcggcc
tggcgcgccgggctgacggcgatcgtctgtgtcggcgagacggaggcgcagcggcgcgcc
ggcgaaacgctggcggtggtcggcgcgcaggtcgccggctcggtgccggacggcgcgcgc
gcggcgacctgcgtcgtcgcctacgagccggtgtgggcgatcggcaccgggctgacgccg
acggcggccgacgtcgccgaggtgcacggcgcgatccgcgccgcgctgacggcgcgcttc
ggcgccgagggcgcggcgatgcggctgctctacggcggctcggtgaagcccgccaacgcc
gccgaactgatggcggtggccgatgtcaacggcgcgctggtcggcggcgcgagcctgaag
gcggcggacttcctcggcatcctggccgcctaccgctga

DBGET integrated database retrieval system