KEGG   Polymorphum gilvum: SL003B_2186Help
Entry
SL003B_2186       CDS       T01458                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00010  Glycolysis / Gluconeogenesis
pgv00051  Fructose and mannose metabolism
pgv00562  Inositol phosphate metabolism
pgv00710  Carbon fixation in photosynthetic organisms
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
pgv01230  Biosynthesis of amino acids
Module
pgv_M00002  Glycolysis, core module involving three-carbon compounds
pgv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_2186 (tpiA)
   00051 Fructose and mannose metabolism
    SL003B_2186 (tpiA)
   00562 Inositol phosphate metabolism
    SL003B_2186 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SL003B_2186 (tpiA)
Enzymes [BR:pgv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SL003B_2186 (tpiA)
Exosome [BR:pgv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SL003B_2186 (tpiA)
  Exosomal proteins of bladder cancer cells
   SL003B_2186 (tpiA)
  Exosomal proteins of melanoma cells
   SL003B_2186 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADZ70611
UniProt: F2IYZ6
Position
2308377..2309135
Genome map
AA seq 252 aa AA seqDB search
MTATIRPLVAGNWKMNGLGASVAEFAAIAGGIDAALATRVDTMICPPATLVARLAEAAAG
TAVAVGGQDCHAAASGAHTGDVSAEMLADAGASAVIVGHSERRTDHNESDALVRAKAQAA
WRAGLTAIVCVGETEAQRRAGETLAVVGAQVAGSVPDGARAATCVVAYEPVWAIGTGLTP
TAADVAEVHGAIRAALTARFGAEGAAMRLLYGGSVKPANAAELMAVADVNGALVGGASLK
AADFLGILAAYR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgacgatcaggccgctggtggccggcaactggaagatgaacggcctcggcgcc
agcgtggcggagttcgccgcgatcgcgggcggcatcgacgccgccctggcgacccgggtc
gacaccatgatctgcccgccggcgacgctggtggcgcggctggccgaggcggccgccggc
acggcggtcgcggtcggcggccaggactgccacgcggcggcctcgggcgcccatacgggc
gacgtctctgccgagatgctggccgatgccggtgccagcgcggtgatcgtcggtcattcg
gagcggcgcaccgaccataacgagagcgacgccctggtgcgggcgaaggcgcaggcggcc
tggcgcgccgggctgacggcgatcgtctgtgtcggcgagacggaggcgcagcggcgcgcc
ggcgaaacgctggcggtggtcggcgcgcaggtcgccggctcggtgccggacggcgcgcgc
gcggcgacctgcgtcgtcgcctacgagccggtgtgggcgatcggcaccgggctgacgccg
acggcggccgacgtcgccgaggtgcacggcgcgatccgcgccgcgctgacggcgcgcttc
ggcgccgagggcgcggcgatgcggctgctctacggcggctcggtgaagcccgccaacgcc
gccgaactgatggcggtggccgatgtcaacggcgcgctggtcggcggcgcgagcctgaag
gcggcggacttcctcggcatcctggccgcctaccgctga

DBGET integrated database retrieval system