KEGG   Polymorphum gilvum: SL003B_2191Help
Entry
SL003B_2191       CDS       T01458                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pgv  Polymorphum gilvum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SL003B_2191
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SL003B_2191
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SL003B_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2314270..2315295
Genome map
AA seq 341 aa AA seqDB search
MTKAFISGCAGALLSDEEAAFFAAEKPWGLILFRRNCVDPDQVRALVRAFRGAVGRGNAP
VLIDQEGGRVQRLKPPHWPDYPPPGRFGTLHARDPRAGLRAAFLGARLIADDLHDLGITV
DCLPLLDVGRPETVDAIGDRAYSPDPAAVAALGRATCDGLMAGGVLPVMKHIPGHGRARV
DSHLVLPRVDAARAEIEAVDLAPFRALADLPLAMTAHLLYEAIDPDHPATQSKAVIGGLI
RGAAGFSGCLMSDDISMQALGGSIAERAALAFSAGCDLVLHCNGDLAEMAAVAEAAPVLT
GAARARCEAALARRSDPVAGFDRAAARAELDALLSAPGGEA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcgttcatcagcggctgcgcgggagcgctcctcagcgacgaggaggcggcg
ttcttcgccgccgaaaagccctggggcctgatcctgttccgccgcaactgcgtcgatccc
gaccaggtgcgcgcgctggtgcgcgccttccgaggagccgtcgggcgcggcaacgcgccg
gtgctgatcgaccaggagggcgggcgcgtgcagcggctcaagccgccgcactggccggac
tacccgccgcctggccgcttcggcacgctgcacgcgcgcgacccgcgggcgggcctgcgc
gccgccttcctgggcgcgcgactgatcgccgacgacctccatgacctgggcatcacggtc
gactgcctgccgctgctcgacgtcggccggccggagacggtcgatgccatcggcgaccgg
gcctattcgcccgatccggctgcagtggccgcactcgggcgggcgacctgcgacgggctg
atggcgggcggggtgctgccggtgatgaagcacattcccggccatggccgcgcccgcgtc
gacagccatctcgtcctgccgcgcgtggacgctgcgcgcgccgagatcgaggcggtcgac
ctcgcgccgttccgcgcgctcgccgacctgccgctggcgatgaccgcgcatctgctctac
gaggcaatcgacccggaccacccggcgacccagtcgaaggcggtgatcggcgggctgatc
cgcggcgcggccgggttttccggctgcctgatgagcgacgacatttccatgcaggcgctc
ggcggtagcatcgccgagcgggccgcgctggcgttttccgccggctgcgacctggtgctg
cactgcaacggcgacctcgccgagatggcggcggtggcggaggcggcgccggtgctcaca
ggcgcggcgcgcgcgcgctgcgaggcggcactggcgcggcgcagcgacccggtcgccggc
ttcgatcgggcggcggcgcgcgccgaactcgacgcgctgctgtcggctcccgggggggag
gcgtga

DBGET integrated database retrieval system