KEGG   Polymorphum gilvum: SL003B_2200Help
Entry
SL003B_2200       CDS       T01458                                 

Definition
L-isoaspartyl protein carboxyl methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pgv  Polymorphum gilvum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2321715..2322395
Genome map
AA seq 226 aa AA seqDB search
MADGDSDTIPTVSRDEIEARAALVLGLRRRGISDRRVLSAIERVPRRLFLAAAHHKLAYE
DSLLPIECGQVVSAPSLVAAMVEALDVQPDSTVLEVGTGSGYQTAVLTHLARQVYSVDRY
ASLVTLARQRLAALRIGNAEIQHADGLLGLKERAPFDRIIVTGAVAEVPEALRAQLAPGG
RIVLPLGPAGAPQALVRLLRDETGERRETLCEVRLVSLRSGIALHL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggggacagcgacacgatcccgaccgtgtcgcgcgacgagatcgaggcgcgc
gcggcgctggtgctcggcctgcgccggcgcggcatcagcgaccggcgcgtgctgtcggcg
atcgagcgcgtgccgcgtcgcctgttcctcgccgccgcccaccacaagctcgcctacgag
gattcgctgctgccgatcgaatgcggccaggtcgtctcggcgccgtcgctggtggcggcg
atggtcgaggcgctcgacgtgcagccggacagcacggtgctagaggtcggcaccgggtcg
ggctaccagactgccgtgctcacgcatctcgcccgtcaggtctacagcgtcgaccgctat
gcgagcctggtgacgctggcgcgccagcgcctggcggcgctgcgaatcggcaatgccgag
atccagcacgccgacggcctgctcggcctgaaggagcgagcaccgttcgaccgcattatc
gtcaccggcgcggtcgcggaggttcccgaggccctgcgcgcgcagcttgcccccggcggc
cgcatcgtgctgccgctcggtccggcgggggcgccgcaagctcttgtccgcctgctgcgc
gacgagacgggcgagcgccgcgagacgctgtgcgaggtgcgcctcgtatccctgcgcagc
ggcatcgcgctgcatttgtga

DBGET integrated database retrieval system