KEGG   Polymorphum gilvum: SL003B_2213Help
Entry
SL003B_2213       CDS       T01458                                 

Gene name
ssb
Definition
ssDNA-binding protein
Orthology
K03111  
single-strand DNA-binding protein
Organism
pgv  Polymorphum gilvum
Pathway
DNA replication
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:pgv03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pgv03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pgv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2336052..2336582
Genome map
AA seq 176 aa AA seqDB search
MAGSVNKVILVGNLGADPEIRRTQDGKPIANLRIATSESWRDRNTGERRERTEWHRVVIF
NEGLCKIAEQYLRKGAKVYIEGQLQTRKWQDQSGQDRYSTEVVLQGFNSALTMLDGRGEG
GGQGAISDYGSSGNDGYGGGSGGSGGGYGGGSGGGYGGGSGGGYGGGGPMDDEIPF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagcgtcaacaaggtcattttggtcggcaacctcggggccgacccggaaatc
cggcgcacccaggacggtaagccgatcgctaacctgcgcatcgcgacctccgaatcctgg
cgcgaccgcaacaccggcgagcggcgcgagcggaccgaatggcaccgagtggtgatcttc
aacgagggcctgtgcaagatcgccgagcagtatctgcgcaagggcgccaaggtctatatc
gaaggccagttgcagacccgcaagtggcaggaccagagcggccaggaccgctattcgacc
gaagtcgtgctgcagggcttcaattcggcgctgaccatgctcgatggccgcggcgagggc
ggcggccagggcgcgatatcggattacggctcgtccggcaatgatggctacggcggcggc
tcgggcggatcgggtggcggctacggcggcggatcgggcggcggctacggcggtgggtcc
ggcggcggctatggcggcggtggaccgatggacgacgagatcccgttctga

DBGET integrated database retrieval system