KEGG   Polymorphum gilvum: SL003B_2213Help
Entry
SL003B_2213       CDS       T01458                                 

Gene name
ssb
Definition
(GenBank) Single-stranded DNA-binding protein
  KO
K03111  
single-strand DNA-binding protein
Organism
pgv  Polymorphum gilvum
Pathway
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SL003B_2213 (ssb)
   03430 Mismatch repair
    SL003B_2213 (ssb)
   03440 Homologous recombination
    SL003B_2213 (ssb)
DNA replication proteins [BR:pgv03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SL003B_2213 (ssb)
DNA repair and recombination proteins [BR:pgv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     SL003B_2213 (ssb)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SL003B_2213 (ssb)
Mitochondrial biogenesis [BR:pgv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SL003B_2213 (ssb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2336052..2336582
Genome map
AA seq 176 aa AA seqDB search
MAGSVNKVILVGNLGADPEIRRTQDGKPIANLRIATSESWRDRNTGERRERTEWHRVVIF
NEGLCKIAEQYLRKGAKVYIEGQLQTRKWQDQSGQDRYSTEVVLQGFNSALTMLDGRGEG
GGQGAISDYGSSGNDGYGGGSGGSGGGYGGGSGGGYGGGSGGGYGGGGPMDDEIPF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagcgtcaacaaggtcattttggtcggcaacctcggggccgacccggaaatc
cggcgcacccaggacggtaagccgatcgctaacctgcgcatcgcgacctccgaatcctgg
cgcgaccgcaacaccggcgagcggcgcgagcggaccgaatggcaccgagtggtgatcttc
aacgagggcctgtgcaagatcgccgagcagtatctgcgcaagggcgccaaggtctatatc
gaaggccagttgcagacccgcaagtggcaggaccagagcggccaggaccgctattcgacc
gaagtcgtgctgcagggcttcaattcggcgctgaccatgctcgatggccgcggcgagggc
ggcggccagggcgcgatatcggattacggctcgtccggcaatgatggctacggcggcggc
tcgggcggatcgggtggcggctacggcggcggatcgggcggcggctacggcggtgggtcc
ggcggcggctatggcggcggtggaccgatggacgacgagatcccgttctga

DBGET integrated database retrieval system