KEGG   Polymorphum gilvum: SL003B_2213Help
Entry
SL003B_2213       CDS       T01458                                 

Gene name
ssb
Definition
ssDNA-binding protein
Orthology
K03111  
single-strand DNA-binding protein
Organism
pgv  Polymorphum gilvum
Pathway
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SL003B_2213 (ssb)
   03430 Mismatch repair
    SL003B_2213 (ssb)
   03440 Homologous recombination
    SL003B_2213 (ssb)
Mitochondrial biogenesis [BR:pgv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SL003B_2213 (ssb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2336052..2336582
Genome map
AA seq 176 aa AA seqDB search
MAGSVNKVILVGNLGADPEIRRTQDGKPIANLRIATSESWRDRNTGERRERTEWHRVVIF
NEGLCKIAEQYLRKGAKVYIEGQLQTRKWQDQSGQDRYSTEVVLQGFNSALTMLDGRGEG
GGQGAISDYGSSGNDGYGGGSGGSGGGYGGGSGGGYGGGSGGGYGGGGPMDDEIPF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagcgtcaacaaggtcattttggtcggcaacctcggggccgacccggaaatc
cggcgcacccaggacggtaagccgatcgctaacctgcgcatcgcgacctccgaatcctgg
cgcgaccgcaacaccggcgagcggcgcgagcggaccgaatggcaccgagtggtgatcttc
aacgagggcctgtgcaagatcgccgagcagtatctgcgcaagggcgccaaggtctatatc
gaaggccagttgcagacccgcaagtggcaggaccagagcggccaggaccgctattcgacc
gaagtcgtgctgcagggcttcaattcggcgctgaccatgctcgatggccgcggcgagggc
ggcggccagggcgcgatatcggattacggctcgtccggcaatgatggctacggcggcggc
tcgggcggatcgggtggcggctacggcggcggatcgggcggcggctacggcggtgggtcc
ggcggcggctatggcggcggtggaccgatggacgacgagatcccgttctga

DBGET integrated database retrieval system