KEGG   Polymorphum gilvum: SL003B_2229Help
Entry
SL003B_2229       CDS       T01458                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pgv  Polymorphum gilvum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SL003B_2229
   00052 Galactose metabolism
    SL003B_2229
   00500 Starch and sucrose metabolism
    SL003B_2229
   00520 Amino sugar and nucleotide sugar metabolism
    SL003B_2229
Enzymes [BR:pgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SL003B_2229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2354425..2355318)
Genome map
AA seq 297 aa AA seqDB search
MMRPIRKAVLPVAGLGTRFLPATKAVPKEMLTIVDRPIIQYVVDEARAAGIEHIVFVTGR
NKHVIEDHFDIAYELEDTLRARSKTAALDLLDKIRPHPGTTSFTRQQEPLGLGHAIWCAR
DIIGDEPFAILLPDVIVKAEKGCLAQMVDVYRERGGNVIAVEEVPEDQTHQYGIVKLAEG
PRSRAMTITGMVEKPAPGTAPSNLMITGRYILQPQIFDLLSRQETGAGGEIQLTDSMKTL
MQTQTFTSVQFEGRSYDCGSKVGFLCANIAFALEQPELAAELMPHLSDLTGLPKAAE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgagacccattcgcaaggctgtcctgcccgttgcaggccttggaacgcgctttctg
ccggccaccaaggccgtgcccaaggaaatgctgaccatcgtcgaccggccgatcatccag
tacgtggtcgacgaggcgcgcgcggccggcatcgagcacatcgtcttcgtcaccggccgc
aacaagcacgtcatcgaggaccatttcgacatcgcctacgaactggaggacacgctgcgc
gcccgctccaagacggcggcgctcgacctcctggacaagatccgtccccatccgggtacg
accagcttcacccgccagcaggagccgctcggccttggccacgccatctggtgcgcccgc
gacatcatcggcgacgagcccttcgccatcctgctgccggacgtcatcgtcaaggcggag
aagggctgcctcgcgcaaatggtcgacgtctatcgggagcgcggcggcaacgtcatcgcg
gtcgaggaggtgcccgaggaccagacgcaccagtacggcatcgtcaagctggccgaggga
ccgcgcagccgggcgatgaccatcaccggcatggtcgagaagcctgctcccggcacggcg
ccgagcaacctgatgatcaccggccgctacatcctgcagccgcagatcttcgacctgctg
tcgcgccaggaaacgggtgccggcggcgagatccagctcaccgacagcatgaagacgctg
atgcagacgcagaccttcacgtcggtgcagttcgaggggcgcagctacgactgcggctcc
aaggtcggcttcctgtgcgcgaacatcgccttcgccctggaacagccggagcttgcggcc
gaactgatgccgcatctgagcgacctgaccggcctgcccaaggccgccgaatag

DBGET integrated database retrieval system