KEGG   Polymorphum gilvum: SL003B_2356Help
Entry
SL003B_2356       CDS       T01458                                 

Definition
(GenBank) Putative diguanylate cyclase (GGDEF)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
pgv  Polymorphum gilvum
Brite
Enzymes [BR:pgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     SL003B_2356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2501762..2502823
Genome map
AA seq 353 aa AA seqDB search
MAEEEDFKRTIVYGESALSYIKRNTLPAYPRNYELWYTYSAGFNHGLNRAINDILTVKGR
ISPEEVQKVYARFLSPNRLSDRIDEVGAKVSDEVNDLVEAIRISTDATSDYGLALEKASA
KLKGLTDTNKLRAVVAHMIKSTHAAVAANKNLENQLLDSRRQIESLQESLESIRYESLTD
ELTTLNNRRHFDLSIDNAVKMAAANEEPFALLLTDIDHFKKFNDNYGHQTGDQVLRLVAL
AVKQNIKGQDTACRYGGEEFAVILPNTSLRDAIAVAENIRKSVLSKELVKRSTGENLGRI
TMSIGVALYRAGDTTQSIIARADAALYAAKRSGRNLVKCETDPEVDQIGSQVA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaggaggatttcaagcgcacgatcgtctacggagaatccgccctctcctac
atcaagcgcaacaccttgcctgcctatccgcgcaattacgaactctggtacacttattcg
gccggattcaatcatgggctgaatcgcgcgatcaacgatatcctcaccgtcaaggggcgg
atctccccggaggaagtccagaaggtctacgcgcgtttcctctcgcccaaccgcctaagc
gatcgcattgacgaggtcggagccaaggtctccgacgaggtcaatgaccttgtcgaggcc
atccggatcagcacggacgcgacttccgactacggcttggcactggagaaagccagtgcc
aagctgaaaggcctgaccgacaccaacaagctgcgagccgtcgtagcccacatgatcaag
tccacgcatgccgccgtggcggccaacaagaatctggagaaccagctgcttgactcgcgc
cgccagatcgagagcctgcaggaaagcttggaatcgatccgttacgaatcgctgaccgac
gaactgaccacactgaacaaccgcaggcatttcgatttgtcgatcgacaacgcggtgaag
atggccgccgcgaacgaagaaccgttcgcattactcctgactgacatcgatcatttcaag
aaattcaacgacaattacggccatcaaaccggcgatcaggtgctccgcctcgtcgctctg
gcggtcaagcagaacatcaagggtcaggacacggcttgccgctacggcggcgaggagttc
gccgtcatcctgccgaacacctcccttcgcgacgccatcgcagtcgccgagaacatccgc
aagtcggtgctgtcgaaggaactggtcaagcgctcgacaggcgagaacctcggtcgcatc
acgatgtcgatcggcgtggctctgtacagagccggcgacacgacccaatccatcatcgcc
cgcgccgatgccgcgctctatgctgccaagcgcagcggtcgcaatctggtcaagtgcgag
accgatccggaagtcgaccagatcggcagccaggtcgcctag

DBGET integrated database retrieval system