KEGG   Polymorphum gilvum: SL003B_2356Help
Entry
SL003B_2356       CDS       T01458                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pgv  Polymorphum gilvum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2501762..2502823
Genome map
AA seq 353 aa AA seqDB search
MAEEEDFKRTIVYGESALSYIKRNTLPAYPRNYELWYTYSAGFNHGLNRAINDILTVKGR
ISPEEVQKVYARFLSPNRLSDRIDEVGAKVSDEVNDLVEAIRISTDATSDYGLALEKASA
KLKGLTDTNKLRAVVAHMIKSTHAAVAANKNLENQLLDSRRQIESLQESLESIRYESLTD
ELTTLNNRRHFDLSIDNAVKMAAANEEPFALLLTDIDHFKKFNDNYGHQTGDQVLRLVAL
AVKQNIKGQDTACRYGGEEFAVILPNTSLRDAIAVAENIRKSVLSKELVKRSTGENLGRI
TMSIGVALYRAGDTTQSIIARADAALYAAKRSGRNLVKCETDPEVDQIGSQVA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaggaggatttcaagcgcacgatcgtctacggagaatccgccctctcctac
atcaagcgcaacaccttgcctgcctatccgcgcaattacgaactctggtacacttattcg
gccggattcaatcatgggctgaatcgcgcgatcaacgatatcctcaccgtcaaggggcgg
atctccccggaggaagtccagaaggtctacgcgcgtttcctctcgcccaaccgcctaagc
gatcgcattgacgaggtcggagccaaggtctccgacgaggtcaatgaccttgtcgaggcc
atccggatcagcacggacgcgacttccgactacggcttggcactggagaaagccagtgcc
aagctgaaaggcctgaccgacaccaacaagctgcgagccgtcgtagcccacatgatcaag
tccacgcatgccgccgtggcggccaacaagaatctggagaaccagctgcttgactcgcgc
cgccagatcgagagcctgcaggaaagcttggaatcgatccgttacgaatcgctgaccgac
gaactgaccacactgaacaaccgcaggcatttcgatttgtcgatcgacaacgcggtgaag
atggccgccgcgaacgaagaaccgttcgcattactcctgactgacatcgatcatttcaag
aaattcaacgacaattacggccatcaaaccggcgatcaggtgctccgcctcgtcgctctg
gcggtcaagcagaacatcaagggtcaggacacggcttgccgctacggcggcgaggagttc
gccgtcatcctgccgaacacctcccttcgcgacgccatcgcagtcgccgagaacatccgc
aagtcggtgctgtcgaaggaactggtcaagcgctcgacaggcgagaacctcggtcgcatc
acgatgtcgatcggcgtggctctgtacagagccggcgacacgacccaatccatcatcgcc
cgcgccgatgccgcgctctatgctgccaagcgcagcggtcgcaatctggtcaagtgcgag
accgatccggaagtcgaccagatcggcagccaggtcgcctag

DBGET integrated database retrieval system