KEGG   Polymorphum gilvum: SL003B_2651Help
Entry
SL003B_2651       CDS       T01458                                 

Gene name
fucA
Definition
class II Aldolase and Adducin N-terminal domain
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pgv  Polymorphum gilvum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SL003B_2651 (fucA)
Enzymes [BR:pgv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SL003B_2651 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2834828..2835541
Genome map
AA seq 237 aa AA seqDB search
MTAPGFPPDSTALREAVIATARALPERGLTRGTSGNVSVRTSNGLLITPSGIPYAALTVD
LIVAMDLDGGYRGDTLPSSEWRMHLDIYLAKPEAGAVVHCHSPRATALSCLRRGIPAFHY
MVALAGGDRIDCAAYATFGTRALSEAMLAALGARNACLLANHGQIACGASLAKALSIAEG
VEELSDQYLSALSVGEPTVLDAAEMAEILRKFRSYGRQPDDLDPDAGPAFELPVRRD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaccgggtttcccgccagacagcacggccctgcgcgaagcggtgatagcgacc
gcgcgggcgctgcccgagcgcgggctgaccagaggcacctcgggcaacgtcagcgtgcgc
acgtccaacggcctgctgatcaccccgtcgggcattccctatgccgctctgacggtcgat
ctcatcgtcgccatggacctcgacggcggctaccggggcgacacgctgccctcgtcggaa
tggcgcatgcatctggacatctacctggccaagccggaggccggcgcggtggtgcactgc
cattcgccgcgggccaccgcgctgtcgtgcctgcggcgcggcattccggccttccactac
atggtggcgctcgccggcggcgatcgcatcgactgcgccgcctacgccaccttcggcacc
cgggcactgtcggaggcgatgctcgccgcgctcggagcgcgcaacgcctgcctgctcgcc
aaccacggccagatcgcctgcggggcgagcctggcgaaggcactgtcgatcgcggaaggc
gtcgaggaactttccgaccagtatctgtcggcgctctcggtgggcgagccgaccgtcctc
gacgcggcggagatggcggaaatcctgaggaagttcagaagctacggccgccagccggac
gacctcgaccccgatgccggaccggccttcgaactgcccgtgcggcgggactga

DBGET integrated database retrieval system