KEGG   Polymorphum gilvum: SL003B_2651Help
Entry
SL003B_2651       CDS       T01458                                 

Gene name
fucA
Definition
class II Aldolase and Adducin N-terminal domain
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pgv  Polymorphum gilvum
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pgv00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2834828..2835541
Genome map
AA seq 237 aa AA seqDB search
MTAPGFPPDSTALREAVIATARALPERGLTRGTSGNVSVRTSNGLLITPSGIPYAALTVD
LIVAMDLDGGYRGDTLPSSEWRMHLDIYLAKPEAGAVVHCHSPRATALSCLRRGIPAFHY
MVALAGGDRIDCAAYATFGTRALSEAMLAALGARNACLLANHGQIACGASLAKALSIAEG
VEELSDQYLSALSVGEPTVLDAAEMAEILRKFRSYGRQPDDLDPDAGPAFELPVRRD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaccgggtttcccgccagacagcacggccctgcgcgaagcggtgatagcgacc
gcgcgggcgctgcccgagcgcgggctgaccagaggcacctcgggcaacgtcagcgtgcgc
acgtccaacggcctgctgatcaccccgtcgggcattccctatgccgctctgacggtcgat
ctcatcgtcgccatggacctcgacggcggctaccggggcgacacgctgccctcgtcggaa
tggcgcatgcatctggacatctacctggccaagccggaggccggcgcggtggtgcactgc
cattcgccgcgggccaccgcgctgtcgtgcctgcggcgcggcattccggccttccactac
atggtggcgctcgccggcggcgatcgcatcgactgcgccgcctacgccaccttcggcacc
cgggcactgtcggaggcgatgctcgccgcgctcggagcgcgcaacgcctgcctgctcgcc
aaccacggccagatcgcctgcggggcgagcctggcgaaggcactgtcgatcgcggaaggc
gtcgaggaactttccgaccagtatctgtcggcgctctcggtgggcgagccgaccgtcctc
gacgcggcggagatggcggaaatcctgaggaagttcagaagctacggccgccagccggac
gacctcgaccccgatgccggaccggccttcgaactgcccgtgcggcgggactga

DBGET integrated database retrieval system