KEGG   Polymorphum gilvum: SL003B_2702Help
Entry
SL003B_2702       CDS       T01458                                 

Definition
cytochrome c subfamily
Orthology
K08738  
cytochrome c
Organism
pgv  Polymorphum gilvum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SL003B_2702
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SL003B_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2886804..2887553
Genome map
AA seq 249 aa AA seqDB search
MRNLAAGAAARRHARRSSLRPGPIAAILTLLSASPVLAGEADAARGETLYKACKTCHQIG
DGARNGVGPHLDALFGRVAGSLDGFKYSSAMKAKGAAGLAWDEATLDAYLAKPQALVPGT
RMSFRGMQAEHDRADLIAYLKAASAGEPSANGDNPAPARPEMGAAAMALAGDPAYGEYLS
SECVTCHQITGRADGIPSIIGWPKEAFIRALFEYKTNVRSHQVMKNMTVNLGNEEIAALA
AYFGSIEPK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacctcgcggcaggcgcggctgcgcgacgccatgcacgacgcagctcgctgcgg
ccggggccgatcgccgccatcctcacgctgctcagcgcctcgccggtccttgccggcgag
gcggatgccgcacgcggcgaaaccctctacaaggcctgcaagacctgccaccagatcggc
gacggcgcccgcaacggcgtcggcccgcatctcgacgcgctgttcgggcgcgtcgccggc
tcgctcgacggcttcaaatattccagcgcgatgaaggccaagggcgcggccggcctggcc
tgggacgaggcaacgctcgacgcctatctggccaagccgcaggcgctcgtgcccggcacc
cgcatgtcgttccgcggcatgcaggcggagcacgaccgagccgacctgatcgcctacctg
aaggctgcctcggcgggcgagccgagcgccaacggcgacaacccggcgcccgcccgaccc
gaaatgggagcggcggcgatggcactcgcaggcgatcccgcctatggcgaatacctgtcc
agcgaatgcgtcacctgccatcagatcactggacgagcggacggaattccctccatcatc
ggctggccgaaggaggcgttcatccgcgcgctgttcgaatacaagaccaacgtgcgctcg
caccaggtcatgaagaacatgaccgtcaatctcggcaacgaggagatcgcggcgctggcc
gcatatttcggctcgatcgagccgaagtag

DBGET integrated database retrieval system