KEGG   Polymorphum gilvum: SL003B_2736Help
Entry
SL003B_2736       CDS       T01458                                 

Gene name
leuA1
Definition
isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
pgv  Polymorphum gilvum
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:pgv01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgv01230]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgv00620]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:pgv00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2924078..2925673)
Genome map
AA seq 531 aa AA seqDB search
MTRERLYLFDTTLRDGAQTSGIDFSVTEKIAIAELLDRLGVDYVEGGYPGANPTDTEFFR
EKRTKRATFTAFGMTKRAGRSVANDPGVQMLLDAAADAICFVAKAWDYHVRVALGCSNEE
NLDAIRDSVEAAVAAGREAMVDCEHFFDGYKANPDYALACARTAHEAGARWVVLCDTNGG
TLPGEVEAIVRAVTAVVPGANLGIHAHDDTGQAVANSLAAVNAGARQIQGTLNGIGERCG
NANLITLIPTLMLKTPYRDRLELGIDAARLTEITAISHAFDEMLNRAPNRHAPYVGESAF
ATKAGIHASAILKEPQTYEHVPPEVVGNKRKVLVSDQAGKSNLLGELARLGVEVDKADPR
LDRLLAEVKEREAAGYAYEAADASFELLARKALGKVPRFFDVKSFRVMVERRHNALGQLV
SVSEAVVKVDVDGETRMNVSEGNGPVNALDGALRKDLGKYQSAIEGLELVDYKVRILDGG
TGAVTRVLIESHDKTTHRRWFTIGVSSNIVDASFQALVDSITYALLKADVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaacgcctctatcttttcgacaccacgctcagggacggtgcccagaccagc
ggcatcgacttctcggtaaccgagaagatcgccatcgcggaactgctcgaccggctcggt
gtcgattatgtcgagggcggctatccgggcgccaatccgaccgacacggaattcttccgg
gaaaagcgcacgaagcgggcgaccttcaccgccttcggcatgaccaagcgggcgggccgg
tcggttgccaacgacccgggcgtgcagatgctgctcgatgccgcggccgacgccatctgc
ttcgtcgccaaggcctgggactaccacgtgcgggtcgcgctcggctgcagcaacgaggag
aacctggacgccatccgcgacagcgtcgaggcggcggtcgccgccggccgcgaggcgatg
gtcgactgcgagcacttcttcgacggctacaaggccaatcccgactacgcgctcgcctgc
gcccgcacggcccacgaggccggggcgcgctgggtcgtgctgtgcgacaccaacggcggc
acgctgccgggcgaggtggaggcgatcgtgcgcgcggtgaccgccgtggtgcccggcgcc
aacctcggcatccatgctcacgatgacaccggccaagcggtggccaattcgctcgccgcc
gtcaacgccggcgcgcgccagatccagggcacgcttaacggcatcggcgagcgctgcggc
aacgccaacctgatcaccctgatcccgacgctgatgctcaagacgccctacagggaccgg
ctcgaactcggcatcgacgcggcacggctgacggagatcacggcgatctcgcacgccttc
gacgagatgctgaaccgcgcgccgaaccggcatgcgccctatgtcggcgaaagcgccttc
gccaccaaggctggcatccacgcctcggcgatcctcaaggagccgcagacctacgagcac
gtaccgccggaagtggtcggcaacaagcgcaaggtgctggtctccgaccaggccggcaag
agcaacctgctcggcgaactggcgcgcctcggcgttgaggtcgacaaggcggacccgcgc
ctcgaccggctgctcgccgaggtcaaggagcgcgaggcggcgggctatgcctacgaggcg
gccgacgcctcgttcgaactgctcgcccgcaaggcgctcggcaaggtgccgcgcttcttc
gacgtcaagtcgttccgcgtcatggtcgaacggcgtcacaacgcgctcggccagctggtc
agcgtctccgaggcggtggtcaaggtcgacgtcgacggagagacgcgcatgaacgtgtcg
gagggcaacggcccggtcaacgccctcgacggggcgctcagaaaggatctgggcaagtac
cagtcggccattgaggggctggaactggtggactacaaggtgcgtatcctcgacggcggc
accggcgcggtcacgcgggttctgatcgagagccacgacaagaccacccaccggcgctgg
ttcaccatcggggtctccagcaacatcgtcgacgcctcgttccaggcgctggtcgattcc
attacctacgcgctgcttaaggcggacgtcgcctga

DBGET integrated database retrieval system