KEGG   Polymorphum gilvum: SL003B_2736Help
Entry
SL003B_2736       CDS       T01458                                 

Gene name
leuA1
Definition
isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
pgv  Polymorphum gilvum
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SL003B_2736 (leuA1)
   01230 Biosynthesis of amino acids
    SL003B_2736 (leuA1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SL003B_2736 (leuA1)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SL003B_2736 (leuA1)
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SL003B_2736 (leuA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2924078..2925673)
Genome map
AA seq 531 aa AA seqDB search
MTRERLYLFDTTLRDGAQTSGIDFSVTEKIAIAELLDRLGVDYVEGGYPGANPTDTEFFR
EKRTKRATFTAFGMTKRAGRSVANDPGVQMLLDAAADAICFVAKAWDYHVRVALGCSNEE
NLDAIRDSVEAAVAAGREAMVDCEHFFDGYKANPDYALACARTAHEAGARWVVLCDTNGG
TLPGEVEAIVRAVTAVVPGANLGIHAHDDTGQAVANSLAAVNAGARQIQGTLNGIGERCG
NANLITLIPTLMLKTPYRDRLELGIDAARLTEITAISHAFDEMLNRAPNRHAPYVGESAF
ATKAGIHASAILKEPQTYEHVPPEVVGNKRKVLVSDQAGKSNLLGELARLGVEVDKADPR
LDRLLAEVKEREAAGYAYEAADASFELLARKALGKVPRFFDVKSFRVMVERRHNALGQLV
SVSEAVVKVDVDGETRMNVSEGNGPVNALDGALRKDLGKYQSAIEGLELVDYKVRILDGG
TGAVTRVLIESHDKTTHRRWFTIGVSSNIVDASFQALVDSITYALLKADVA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaacgcctctatcttttcgacaccacgctcagggacggtgcccagaccagc
ggcatcgacttctcggtaaccgagaagatcgccatcgcggaactgctcgaccggctcggt
gtcgattatgtcgagggcggctatccgggcgccaatccgaccgacacggaattcttccgg
gaaaagcgcacgaagcgggcgaccttcaccgccttcggcatgaccaagcgggcgggccgg
tcggttgccaacgacccgggcgtgcagatgctgctcgatgccgcggccgacgccatctgc
ttcgtcgccaaggcctgggactaccacgtgcgggtcgcgctcggctgcagcaacgaggag
aacctggacgccatccgcgacagcgtcgaggcggcggtcgccgccggccgcgaggcgatg
gtcgactgcgagcacttcttcgacggctacaaggccaatcccgactacgcgctcgcctgc
gcccgcacggcccacgaggccggggcgcgctgggtcgtgctgtgcgacaccaacggcggc
acgctgccgggcgaggtggaggcgatcgtgcgcgcggtgaccgccgtggtgcccggcgcc
aacctcggcatccatgctcacgatgacaccggccaagcggtggccaattcgctcgccgcc
gtcaacgccggcgcgcgccagatccagggcacgcttaacggcatcggcgagcgctgcggc
aacgccaacctgatcaccctgatcccgacgctgatgctcaagacgccctacagggaccgg
ctcgaactcggcatcgacgcggcacggctgacggagatcacggcgatctcgcacgccttc
gacgagatgctgaaccgcgcgccgaaccggcatgcgccctatgtcggcgaaagcgccttc
gccaccaaggctggcatccacgcctcggcgatcctcaaggagccgcagacctacgagcac
gtaccgccggaagtggtcggcaacaagcgcaaggtgctggtctccgaccaggccggcaag
agcaacctgctcggcgaactggcgcgcctcggcgttgaggtcgacaaggcggacccgcgc
ctcgaccggctgctcgccgaggtcaaggagcgcgaggcggcgggctatgcctacgaggcg
gccgacgcctcgttcgaactgctcgcccgcaaggcgctcggcaaggtgccgcgcttcttc
gacgtcaagtcgttccgcgtcatggtcgaacggcgtcacaacgcgctcggccagctggtc
agcgtctccgaggcggtggtcaaggtcgacgtcgacggagagacgcgcatgaacgtgtcg
gagggcaacggcccggtcaacgccctcgacggggcgctcagaaaggatctgggcaagtac
cagtcggccattgaggggctggaactggtggactacaaggtgcgtatcctcgacggcggc
accggcgcggtcacgcgggttctgatcgagagccacgacaagaccacccaccggcgctgg
ttcaccatcggggtctccagcaacatcgtcgacgcctcgttccaggcgctggtcgattcc
attacctacgcgctgcttaaggcggacgtcgcctga

DBGET integrated database retrieval system