KEGG   Polymorphum gilvum: SL003B_3006Help
Entry
SL003B_3006       CDS       T01458                                 

Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pgv  Polymorphum gilvum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pgv01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgv00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pgv00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3232777..3234939)
Genome map
AA seq 720 aa AA seqDB search
MQDRVEVDGLKVARELYDFVNARALPGTGVEPATFWKELSAIVHDLAPKNRALLARRDAF
QAKIDAWHRAHPGVPDMAAYKAFLTEIGYLVPEGGAFTVTTANVDPEISTVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAMGSLPAGGGFDPARGAEVIAYARKLLDEVAPLAS
GSWADIIGCSVSGGALSVATDGGAVALADPSQFAGHDGDAAAPSKVLLARNGLHLEIVID
ADHPIGRTDKAHIADVIVESAMSTIMDCEDSVAAVDAEDKVVVYGNWLGLMKGDLEETFE
KSGKMMTRRMNGDRTYTAPDGSQLTLHGRSLLLVRNVGHLMTIDAVLDRDGNEVPEGILD
GMVTALIALHDIGPSGRRANSRAGSVYIVKPKMHGPEEVAFACELFDRIEDALGMARNTL
KMGIMDEERRTTVNLKECIRAAKDRVFFINTGFLDRTGDEMHTSMEAGPMIRKGDMKTAT
WIAAYENNNVDVGLACGLPGHAQIGKGMWAMPDLMHAMLEQKLGHPMAGANTAWVPSPTA
ATLHALHYHKVNVAGRQADLKSRAKARLEDILSIPVATRPNWSPEDIQAELDNNAQGILG
YVVRWVEQGVGCSKVPDINNIGLMEDRATLRISSQHIANWLRHGVCSKDQVMETMKRMAA
LVDKQNAGDPNYRPMSADYDASVGFQAACDLVFKGCEQPNGYTEPVLHRRRLEFKAKQAV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcgggtcgaggtcgacgggctgaaggtcgcgagggaactctacgacttcgtc
aacgcgcgcgccctgccggggaccggcgtcgagccggcgaccttctggaaggaactgtcc
gccatcgtgcacgatctcgcgccgaagaaccgcgccctgctcgcccgacgcgacgcgttt
caggcgaagatcgatgcctggcaccgggcccatccgggcgtgcctgacatggcggcctac
aaggctttcctgaccgagatcggctacctggtaccggagggcggcgccttcactgtgacc
accgccaacgtcgatccggaaatctccaccgtcgcgggtccgcagcttgtcgtgccggtg
atgaacgcccgttatgcgctcaacgccgccaacgcccgctggggctcgctctacgacgcg
ctctacggcaccgacgcgatggggtcgctgcctgcgggcggcggcttcgatccggcgcgc
ggcgcagaggtgatcgcttatgcgcgcaagctgctggacgaggtggcgccgctcgcttcc
ggctcctgggccgacatcatcggctgttccgtttccggcggcgcgctgagcgtcgcgacc
gacggcggtgccgtcgcgctcgccgacccgtcccagttcgccggccatgacggcgatgcg
gccgctccgtccaaggtgttgctcgccaggaacggcctgcatctggaaatcgtcatcgac
gccgaccatccgatcggcaggaccgacaaggcgcatatcgccgacgtgatcgtcgagtcg
gccatgtccacgatcatggactgcgaggattcagtcgccgccgtcgacgccgaggacaag
gtcgtggtctacggcaactggctcggcctgatgaagggcgacctcgaggagaccttcgag
aagtcgggcaagatgatgacgcggcgcatgaacggcgacaggacgtacacggcgccggac
ggctcgcagctcacgctgcacggacgctcgctgctgctggtgcgcaacgtcggccacctg
atgaccatcgacgcggtgctggaccgggacggcaacgaggtgccggaaggcatcctcgac
ggcatggttaccgcgctgatcgcgctgcacgacatcgggccgagcggccggcgcgccaat
tcccgcgccggctcggtctatatcgtcaagccgaagatgcacgggcccgaggaggtcgcc
ttcgcctgcgaactgttcgaccgcatcgaggacgcactcggcatggcgcgcaacacgctg
aagatgggcatcatggacgaggagcgccgcaccacggtcaacctcaaggaatgcatccgc
gcggcgaaggatcgggtgttcttcatcaacaccggcttcctggaccgcaccggcgacgag
atgcacacgtcgatggaagcaggtcctatgatccgcaagggcgacatgaagacggccacc
tggatcgcggcctacgagaacaacaacgtcgacgtcggcctggcctgcggcctgccgggc
catgcccagatcggcaagggcatgtgggccatgcccgacctgatgcacgcgatgctggag
cagaagctcggccatccgatggccggtgccaacaccgcctgggtgccgtcgccgacggcg
gccacgctgcacgcgctgcactaccacaaggtcaacgtcgccgggcggcaggcggacctt
aagtcgcgtgccaaggccaggctggaggacatcctgtcgataccggtcgcgacccggccg
aactggtcgcccgaggacatccaggccgagctcgacaacaacgcgcaaggaattctcggc
tacgtggtgcgttgggtcgagcagggcgtgggctgctccaaggtgccggacatcaacaac
atcggcctgatggaggaccgcgccaccctgcgcatttcctcgcagcacatcgccaactgg
ctgcgccatggcgtctgctcgaaggaccaggtcatggagaccatgaagcggatggcggcg
ctggtcgacaagcagaacgccggcgatccgaactaccggccgatgtcggcggactacgac
gcctcggtcggcttccaggccgcctgcgacctcgtcttcaaagggtgcgagcagccgaac
ggctacaccgagccggtgttgcaccgtcgccgcctcgaatttaaggcgaagcaggcggtc
tga

DBGET integrated database retrieval system