KEGG   Polymorphum gilvum: SL003B_3047Help
Entry
SL003B_3047       CDS       T01458                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pgv  Polymorphum gilvum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pgv00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3282688..3283542)
Genome map
AA seq 284 aa AA seqDB search
MSILSLNQLREGASPLAMTEALIALALEAGTAILAVYETAGAARSEAKADGSPVTEADEA
AEKVILAGLAALAPEVPVVAEEAVAAGDIPPVSGPYFLVDPLDGTREFIKRNGEFTVNIA
LVEDGVPVLGVVLAPALGEIYWGDATGAWSGRVAGAAVVERRPIAVRRRPEGGLGVLASR
SHLSEETSALIDRLPVAELLSVGSSLKLCWVAAGRADVYPRLSPTMQWDIAAGHAVLRAA
GGRALAAGTREELAYRLPPVPGRDDLVNRHFIAIGDQDLIDLVA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgagtatcctatcgctgaaccagctgcgcgagggcgcatcgccgttggccatgaccgag
gcactgatcgcgctcgcgctcgaggccggcacggccatcctggcggtctacgaaaccgcc
ggcgcggcccgatccgaagccaaggccgacggctcgccggtcaccgaggcagacgaggcg
gccgagaaggtgatccttgccggtctcgccgcgcttgcgccggaagttccggtggtcgcg
gaggaggcggtcgccgccggcgacattccgccggtgtccggcccgtatttcctggtcgat
ccgctcgacggcacgcgcgagttcatcaagcgcaacggcgagttcaccgtcaacatcgcc
ctggtcgaggacggcgtgccggtgctcggcgtcgtgctggcgcccgccctcggcgagatc
tactggggcgatgcgaccggcgcctggtccgggcgcgtcgccggtgcggcggtcgtcgag
cgccggccgatcgccgttcggcgccggccggaaggcggcctcggcgtgctcgccagccgc
tcgcacctgtccgaggagaccagcgcgctgatcgaccggctgccggtcgccgaactgctg
tcggtcggctcgtcgctgaagctgtgctgggtggcggccggtcgcgcggacgtctatccg
cgcctgtcgccgaccatgcagtgggacatcgccgccggccatgccgtgctgcgcgccgcc
ggcgggcgggcgcttgcggccggcacgcgcgaggaactcgcctaccggctgccgccggtg
ccggggcgcgacgacctcgtcaatcgccatttcatcgccatcggcgaccaggacctcatc
gacctggtggcgtga

DBGET integrated database retrieval system