KEGG   Polymorphum gilvum: SL003B_3104Help
Entry
SL003B_3104       CDS       T01458                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase 1
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00340  Histidine metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SL003B_3104 (hisD)
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SL003B_3104 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADZ71526
UniProt: F2IWU9
Position
complement(3343137..3344432)
Genome map
AA seq 431 aa AA seqDB search
MAIRLSSDQADFEPRFSALLAGKREVSEDVDLIVRDILDDVRARGDAAVVDYTNRFDRVS
VTGFEQLTVRQDEIDAAIGQVPAETLDALRFARDRIHAHHARQMPKDDRYTDPIGVELGS
RWTAIEAVGLYVPGGLASYPSSVLMNAVPALVAGVERIAMVVPSPDGVLNPLVLAAAKVA
GITEIYRIGGAQAIAALAYGTQSLAPVSKIVGPGNAFVAAAKRRVFGTVGIDMIAGPSEI
LVVADAENDPDWLAADLLAQAEHDPVAQSILITDDVGLARAVEEAVDRQLRTLPRGEVAG
ASWRDFGAVILVASLEEALPLVNRIAPEHLELAVADPEALLAGVRNAGAVFLGRYTPEAI
GDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILKCSAETLRALGPAAIALGEAEGLGG
HARSVAIRLNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggccatccgactgtcgagtgaccaggccgatttcgaaccccgcttttccgcgttgctg
gccggcaagcgcgaggtatccgaagacgtcgacctgatcgtacgggacattctcgacgat
gtgcgcgcgcgtggcgacgcggcggtcgtcgactacacgaaccgcttcgatcgggtttcg
gtcaccggcttcgagcaattgaccgtgcgccaggacgagatcgatgcggccatcggccag
gttcccgccgagacgctcgacgcgctgcgcttcgcgcgtgatcgcattcacgcccatcat
gcccgacagatgccgaaggacgaccgctacacggatccgatcggcgtcgaactcggctcg
cgttggacggcgatcgaggcagtcggtctctacgtgccgggcggccttgccagctatccg
agttcggttctgatgaatgctgtgccggcccttgtcgcaggcgtcgagcgcatcgcgatg
gtggtgccgagcccggacggtgtcctcaacccgctggtgcttgcggcggccaaggtggcc
gggatcaccgagatctatcgcatcggcggcgcccaggcgatcgcggcgctcgcctatggc
acgcagtcgctcgccccggtcagcaagatcgtcgggccaggcaatgccttcgtcgcggcg
gccaagcggcgcgtcttcggtaccgtcggcatcgacatgatcgcgggcccctcggagatc
ctggtggtggctgatgcggagaacgatccggactggctcgcggcggatctgctcgcccag
gctgagcacgatccggttgcacagtcgatcctgatcacggacgacgtcggtctggcgcgg
gcggtggaagaggcggtcgaccgccagttgcggacgctgccgcgcggcgaggtcgccggc
gcgagctggcgcgatttcggtgcggtcatcctggtcgcctcgctggaggaggcgctgccg
ctggtcaaccgcatcgcgccggaacatctggaactcgccgtcgccgatccggaggcgctg
ctggccggcgtccgcaacgccggcgccgtcttcctcgggcgttacaccccggaggcgatc
ggcgactatgtcggcggctccaaccacgtgttgccgacggcgcgctcggcgcggttttcc
tcggggctttcggtgcttgactttgtcaagcggacatcgatccttaagtgctcggcggag
acgttgcgggcgcttggtcccgcggcgatcgcccttggcgaggccgaaggacttggcggt
cacgcccggtccgttgcgatcagactgaacctttag

DBGET integrated database retrieval system