KEGG   Polymorphum gilvum: SL003B_3106Help
Entry
SL003B_3106       CDS       T01458                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pgv  Polymorphum gilvum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pgv00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pgv00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3345051..3346340)
Genome map
AA seq 429 aa AA seqDB search
MDSIKIVGGTQLNGAIPISGAKNAALPLMIASLLTDETLTLENVPRLRDVAQLTHILTNH
GVDYSVDGKRLGQDQLTGQTVHLRAREVVDTTAPYELVSKMRASFWVVGPLVARMGRARV
SLPGGCAIGTRPVDFFIEGLKALGADIDIDSGYVVAQAPNGLRGGRVTFPKVSVGATHTL
MMAAALARGETELVNAAREPEVVDLADCLVGMGARIEGAGTGTIRIQGVERLSGHRHSVI
PDRIETGTYAMAVAMTGGDVVLEGARGDLLEAALDVLRQTGAEITETNSGLRIYRNGNGI
ASVDVTTEPYPGFPTDLQAQFMALMTRAHGHSRITETIFENRFMHVQELARLGARIRIDG
HTAIVEGVPALRGAPVMATDLRASVSLVIAGLAAEGETTVSRVYHLDRGFERLEEKLGRC
GAQIERISA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacagcatcaagatcgtcggcggcacgcagctcaacggtgcgattccgatctccggc
gccaagaacgccgccctgccgctgatgatcgcgtccctgcttaccgacgagaccctgacg
ctcgaaaacgtgccgcgcctgcgcgacgtcgcccagctcacccacatcctgaccaaccac
ggcgtcgactattccgtcgacggcaagcgtctcggccaggaccagctgaccggccagacg
gtgcatctgcgcgcccgcgaggtcgtcgacaccacggcgccctacgagctggtgtcgaag
atgcgcgcgagtttctgggtggtcgggccgctggtcgcgcgcatggggcgggcccgggtt
tcgctcccaggcggctgcgccatcggcacccggccggtcgacttcttcatcgaggggctg
aaggcgcttggcgccgacatcgacatcgactccggctatgtggtggcgcaggcgccgaac
ggcttgaggggcgggcgcgtgaccttcccgaaggtctcggtcggcgcgacccataccctg
atgatggcggccgcacttgcgcgtggcgagacggaactggtcaacgcggcgcgcgaaccg
gaggtcgtggacctcgccgactgccttgtcggcatgggtgcccgcatcgagggcgcgggc
accggcacaatccgcatccagggcgtcgagcgcctgtccggccatcgccattcggtcatc
cccgaccggatcgagaccggaacctacgccatggccgtggccatgaccggcggagatgtc
gtgctggagggcgcgcgcggcgaccttctggaggccgcgctcgacgtgttgcggcagacc
ggtgccgagatcaccgagaccaattccgggctgcggatctatcgcaacggcaacggcatc
gcctcggtcgacgtgacgaccgagccctatccgggcttcccgaccgatctgcaggcccag
ttcatggccctgatgacccgggcccacggccacagccgcatcacggagacgatcttcgag
aaccgcttcatgcacgtccaggaactggcgcgcctcggtgcccgcatccgcatcgatggc
catacggcgatcgtcgagggcgtgccggccctgcgcggggcaccggtgatggccaccgac
ctgcgcgcctccgtctccctggtcatcgccgggcttgccgccgagggcgagaccacggtc
agccgcgtctaccacctcgatcgcggcttcgaacggctggaggaaaagcttggccggtgc
ggcgcccagatcgagcggatctcggcctga

DBGET integrated database retrieval system