KEGG   Polymorphum gilvum: SL003B_3145Help
Entry
SL003B_3145       CDS       T01458                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_3145
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_3145
   00620 Pyruvate metabolism
    SL003B_3145
   00640 Propanoate metabolism
    SL003B_3145
  Energy metabolism
   00680 Methane metabolism
    SL003B_3145
Enzymes [BR:pgv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SL003B_3145
Lipid biosynthesis proteins [BR:pgv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SL003B_3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3386291..3387850
Genome map
AA seq 519 aa AA seqDB search
MTRLTEFTSYSDAQRHFSNEALWDLFDGDRNRLNIAHECIDRHADTDRVALRIAHADGRD
EVITFAEISRRSAQVAHYLRRRGIEKGDRVAVMIEPSLPFYCAIFGAMKAGAVAVPMFTL
FGPDGIRLRAEDCTPEVFFTNAEKAPDAIQAGTKGVTIADDAFLDSIADLPERFDWETSD
DDLAVLQYTSGTTRLLPAAVRHNHRSIVTLMVAALYATGIRPGDRFFCPSSPAWGHGLWH
GTLAPLALGVSTGTFSGRFDPVRLLKALQDFGITNLSAAATHYRMMRNSGRAEVFSYAIR
KLSFTGEPIDSETSRYVERLFGTKVCSMYGTTEIGVILANYPGAPDFEVREGSLGKPVPG
IEVEVHGPDGRPVAPGEIGELMLRRRGEWFPTKDLGRTDADGYFYHAGRADDVIISAGWT
MSAVEIEDAILRHPLVAEAAAIGVPDAVRGQVVKAFVVLKGAPSGDLVAEIQELVRTNLS
RHEYPRQIEFVKALPKTPAGKVNRKALRDAEAREQVGTA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcctgacggagttcacgtcgtattcggatgcccagaggcatttctcgaacgag
gctctctgggacctgttcgatggcgaccggaatcggctgaacatcgcgcatgaatgtatc
gaccggcatgccgacaccgatcgtgtagcattgcgcatcgcccatgcagacggccgcgac
gaggtgattaccttcgccgagatcagccggcgctcggctcaagtcgcccactatctcagg
cgtcgcggcatcgagaagggcgaccgtgtcgcggtgatgatcgaaccgtccctgcccttt
tactgcgcgatcttcggcgccatgaaggccggcgcggtggccgtgccgatgttcaccctg
ttcgggcccgacggcatccgcctgcgggccgaggactgcacgccggaagtctttttcacc
aacgcggagaaggcaccggacgcgatccaggcgggcaccaagggcgttaccatcgccgac
gacgcgttcctcgactccattgccgatctgcccgagcggttcgactgggagacctcggac
gacgatctggcggttctccaatatacctcgggcacgacgcgcctgttgcccgccgccgtg
cgtcacaaccaccgctccatcgtcacgctgatggttgcggcgctctacgcgacgggcatc
cggccgggcgatcgcttcttctgtccctcctcgccggcctgggggcacggactgtggcat
ggaacgctggcgccgctggcgctcggcgtcagcaccggcacgttcagtggcaggttcgat
ccggtccgcctgctgaaggcgctgcaggatttcggcatcaccaacctgtcagcggccgcg
acgcactacaggatgatgcgcaattccgggcgcgcggaggtcttcagctacgccatccgc
aaactgtccttcacgggcgaaccgatcgacagcgagacctcccgttacgtcgagcggctg
ttcggcaccaaggtctgcagcatgtacggcacgaccgagatcggcgtgatcctcgccaac
tatcccggagcgccggacttcgaggtgcgtgaagggtctctcggcaaacctgttcccgga
atcgaggtcgaggtgcacggtcccgatggcaggccggtcgcgccgggcgagatcggcgaa
ctgatgctgcgcagacgtggagaatggtttccgaccaaggacctcgggcgcaccgacgcg
gacggatacttctatcatgccggccgggccgacgatgtgatcatttccgccggctggacc
atgagcgctgtggagatcgaggacgccatcctgcgccatcctctggtcgccgaagcggct
gcgatcggtgttcccgacgcggttcgcggccaggtggtcaaagccttcgtggtcctgaaa
ggcgcgccatccggagatctcgtcgcagagatccaggaactcgtgcgcacgaacctcagc
cgacacgaatacccccgccagatcgaattcgtgaaggcattgccgaagacgcccgcgggc
aaggtcaatcgcaaggccctgcgcgacgccgaggcgagggaacaagtcggcacggcgtga

DBGET integrated database retrieval system