KEGG   Polymorphum gilvum: SL003B_3388Help
Entry
SL003B_3388       CDS       T01458                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthetase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pgv  Polymorphum gilvum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SL003B_3388 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SL003B_3388 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SL003B_3388 (thrC)
Enzymes [BR:pgv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SL003B_3388 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3659056..3660462)
Genome map
AA seq 468 aa AA seqDB search
MKYISTRGEAPVLDFAEVLLQGLARDGGLYLPESWPQVSPATIAGFAGRPYAEVAFEVIA
PFVGDSIAPEALRRMIDASYGAFRHPAVTPLIQVAPNRFVLELFHGPTLAFKDVAMQLLG
RLMDHVLAERGQRATIVGATSGDTGGAAIEAFRGRERTDVFILFPDGRVSEVQRRQMTTP
SEANVHALALTGNFDDCQAIVKGLFNHFAFRDRVALSGVNSINWARIVAQIVYYFVAGAA
LGAPHRPVSFTVPTGNFGDIFAGYAAMKMGLPVERLVIATNVNDILVRTLETGRYETRGV
TATTAPSMDIQVSSNFERLLAEACGRDGSAVRGAMNRLAQSGSFEIAAGPLADIRRSFAA
GRCDEAETAATIGTTWREAGYLLDPHTAIGEHVARAHDRPGAPMVVLGTAHPAKFPDAVE
AAAGVRPDLPERLLPMMSAVERQTVLPADQAAVERHIEAHARAVRGTV
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacatcagtacgcgcggcgaagcccccgtcctcgactttgccgaggttctcctg
cagggcctggcgcgcgacggcggcctctaccttcccgaaagctggccgcaagtctcgccg
gcgaccattgccggctttgccgggcgtccctatgccgaggtcgccttcgaggtgatcgct
ccgttcgtcggcgacagcatcgcgccggaggcgctgcggcggatgatcgacgcctcctat
ggcgccttccgccatccggcggtgacgccactgatccaggtcgcgcccaaccgcttcgtg
ctcgagttgttccatggcccgacgctcgccttcaaggacgtcgccatgcagctgctcgga
cggctgatggaccacgtcctcgccgagcgcggccagcgcgccaccattgtcggcgcgacc
tccggcgataccggcggcgccgccatcgaggccttccgcggtcgcgagcgcaccgacgtg
ttcatcctgttcccggacggacgcgtctccgaggtgcagcgccgccagatgaccacgcca
tcggaggccaacgtccacgcgctggcgctgaccggcaacttcgacgactgccaggcgatc
gtgaagggcctgttcaatcactttgccttccgcgaccgggtcgccctgtccggcgtcaac
tcgatcaactgggcccgcatcgtcgcccagatcgtctattacttcgttgccggagccgcc
ctcggcgcgccgcaccgccccgtctccttcaccgtgccgaccggcaatttcggcgacatc
ttcgccggctacgcggcgatgaagatgggcctgccggtcgagcggctggtgatcgccacc
aacgtcaacgacattctggttcgcacgctggaaacggggcgctacgagacgcgcggcgtc
accgccaccacggcgccgtcgatggacatccaggtgtcgtcgaacttcgagcgtctgctc
gccgaggcctgcgggcgcgatggctcggcagtgcgcggtgcgatgaaccgccttgcccag
tccggcagcttcgaaatcgccgccgggccgctcgccgacatccgccggagttttgccgcc
ggacgctgcgacgaggccgagactgcggcgacgatcggcacgacctggcgcgaggcgggc
tatctgctcgacccgcacaccgcgatcggcgagcatgtcgcgcgtgcccacgaccgccct
ggcgcgccgatggtggtgctcggcaccgcccatccggccaagttcccggacgcggtcgag
gccgccgccggcgttcgcccggacctgccggagcggctgctgccgatgatgtctgcggtc
gagcgccagaccgtgctgccggccgaccaggcggcggtcgagcgccacatcgaggcgcat
gcccgggcggtgcgcggtaccgtttga

DBGET integrated database retrieval system