KEGG   Polymorphum gilvum: SL003B_3479Help
Entry
SL003B_3479       CDS       T01458                                 

Definition
peptide chain release factor 2
Orthology
K08738  
cytochrome c
Organism
pgv  Polymorphum gilvum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SL003B_3479
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SL003B_3479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3758136..3758534
Genome map
AA seq 132 aa AA seqDB search
MKNVTVLASVAFLALTATAFADGDAAKGEKVFKKCQACHDVGANAKNKVGPELNGIVGRK
IASIEGFKYSPAMIEFGAGDKVWDEATLTTYLHNPKEAIPKNKMAFVGLKKDDDLSDVIA
YLSQFNEDGSAK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgtcacggtccttgccagcgtggcgtttcttgcgctgaccgcgacggccttc
gccgacggcgacgcggcaaagggcgaaaaggtcttcaagaagtgccaggcctgccacgat
gtcggcgccaacgcgaagaacaaggtcggaccggaattgaacggcatcgtcggccgcaag
atcgcgtcgattgaaggcttcaagtattccccggccatgatcgagttcggcgcgggcgac
aaggtctgggacgaagcgacgctcaccacctacctgcacaacccgaaggaagcgatcccg
aagaacaagatggccttcgtcggtctgaagaaggacgacgacctgtcggacgtcatcgcc
tacctgagccagttcaacgaagacggttcggcgaagtaa

DBGET integrated database retrieval system