KEGG   Polymorphum gilvum: SL003B_3479Help
Entry
SL003B_3479       CDS       T01458                                 

Definition
peptide chain release factor 2
Orthology
K08738  
cytochrome c
Organism
pgv  Polymorphum gilvum
Pathway
Sulfur metabolism
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pgv00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pgv02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3758136..3758534
Genome map
AA seq 132 aa AA seqDB search
MKNVTVLASVAFLALTATAFADGDAAKGEKVFKKCQACHDVGANAKNKVGPELNGIVGRK
IASIEGFKYSPAMIEFGAGDKVWDEATLTTYLHNPKEAIPKNKMAFVGLKKDDDLSDVIA
YLSQFNEDGSAK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgtcacggtccttgccagcgtggcgtttcttgcgctgaccgcgacggccttc
gccgacggcgacgcggcaaagggcgaaaaggtcttcaagaagtgccaggcctgccacgat
gtcggcgccaacgcgaagaacaaggtcggaccggaattgaacggcatcgtcggccgcaag
atcgcgtcgattgaaggcttcaagtattccccggccatgatcgagttcggcgcgggcgac
aaggtctgggacgaagcgacgctcaccacctacctgcacaacccgaaggaagcgatcccg
aagaacaagatggccttcgtcggtctgaagaaggacgacgacctgtcggacgtcatcgcc
tacctgagccagttcaacgaagacggttcggcgaagtaa

DBGET integrated database retrieval system