KEGG   Polymorphum gilvum: SL003B_3675Help
Entry
SL003B_3675       CDS       T01458                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_3675
   00052 Galactose metabolism
    SL003B_3675
Enzymes [BR:pgv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SL003B_3675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3978831..3979841)
Genome map
AA seq 336 aa AA seqDB search
MIRSFGTMDDGTVVEEIRLRADRLEAKILTFGATVRDLRLGGRPLVLGFDSLADYIAHGQ
HFGSIAGRCANRIAGGRFSLDGTDYQLSRNLPGGDHLHGGVTGFGTRVWTIKETRAESVL
LGLVSPDGEEGYPGRVEVFCRYTLTQAGALVVELTGTTDRPTLLNLAHHSYFNLDESADI
LDHRLHIVADRYLPMSPAALPAGEVAEVAGTPFDFRNARPVRMLFDDGARVIYDHNFCLA
DAPRAEPHLAAVLEGPRSGIAMDLWTTEPGLQLYDAYKLDLPYQGLDGRRYGPNAGLCLE
PQRWPDSPNHPDFAGAVLRPGETYRQVTEFRFHPGV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatccggtccttcggcaccatggatgacggcacggtcgtggaggagatccgcctccgc
gccgaccgtctcgaggcgaagatcctgaccttcggcgcgaccgtccgtgacctgcgcctc
ggcggccgtccgctggtcctcggtttcgacagcctggccgattacatcgcccatggtcag
cacttcggctcgatcgctggccgctgcgccaaccgcatcgccggcggccgcttcagcctc
gacggaacggattaccagttgagccgtaacctgccgggcggcgaccacctgcacggtggc
gtgaccggcttcggcacccgggtctggacgatcaaggagacccgggcggagtccgtcctg
ctcggcctcgtctcgccggacggcgaggagggctatcccggccgggtcgaggtgttctgc
cgctacacgctcacgcaggcaggcgcactcgtggtcgaactcaccggcaccaccgaccgg
ccgaccctgctcaacctcgcccatcacagctacttcaacctcgacgaatctgccgacatc
ctcgaccaccggctccacatcgttgccgaccgctacctgccgatgagcccggccgccctg
ccggccggcgaggttgccgaggtcgccggcacgccgttcgacttccgcaatgcgagaccc
gtccggatgctgttcgacgacggcgcgcgggtgatctacgaccacaacttctgtctcgcc
gacgccccgcgcgcggagccgcacctggccgccgtcctggaagggccgagatcgggcatc
gcgatggacctgtggaccaccgagcctgggcttcagctctacgacgcctacaagctcgac
ctgccctatcagggtctcgacgggcgccgctacggtcccaacgccggcctgtgcctcgag
ccgcagcgctggccggatagcccgaaccatccggacttcgccggcgccgtcctgcggccg
ggcgagacctatcgccaggtcaccgagttccgcttccacccgggggtctga

DBGET integrated database retrieval system