KEGG   Polymorphum gilvum: SL003B_3678Help
Entry
SL003B_3678       CDS       T01458                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pgv  Polymorphum gilvum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SL003B_3678
Enzymes [BR:pgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SL003B_3678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3982016..3982921)
Genome map
AA seq 301 aa AA seqDB search
MIVVFGSVNLDLVVAVPRLPAAGETVVGPDHQSFPGGKGANQALAACRAGAEVALVGAVG
TDAFAAPALAGLKAVGVDLSAVRVLDGATGLAMIGVDAAGENLILVASGVNARVDAAWLD
GRLGPVSTLLMQVELPLPALQAATARARAAGSRIVLNAAPVAGPGVGDLAAAADVVVVNE
SETADLGAVLGLPTDPEGFARTLAAAGRAAVVTLGAGGVLAHDGSRPWRLRPPPTAVVDT
TGAGDAFCGALAAALDRGAGLGRALAEGVAAGSLACMATGAQSSAPDAARIAALADTLEA
C
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtgttcggatcggtcaacctcgacctcgtcgtcgccgtgccgcgcctgccg
gccgccggcgagaccgtcgtcggccccgatcaccagagcttcccgggcggcaagggcgcc
aaccaggcgctcgccgcgtgccgcgccggcgccgaggtcgcgctcgtcggcgccgtcggc
accgatgccttcgccgcccccgcgctcgccggcctgaaggccgtcggcgtcgacctgtcc
gccgtacgggtgctcgacggcgcgaccggtctggccatgatcggcgtcgacgccgccggc
gagaacctcatcctcgtcgccagcggcgtcaatgcccgggtggacgctgcctggctcgac
ggccggctcgggccggtctcgaccctgctgatgcaggtcgagctgccgcttcccgccctg
caggcggcgacggcccgcgcccgggccgccggcagccggatcgtcctcaacgccgcgccg
gtcgccggccccggcgtcggcgacctcgccgccgccgcggatgtggtcgtcgtcaacgag
agcgagaccgccgacctcggcgcggttctcggcctgccgaccgatcccgagggcttcgcc
cgcacccttgccgccgcggggcgggccgccgtcgtcaccctcggcgccggcggcgtgctg
gcccatgacggcagccggccctggcggcttcgcccgccgccgacggcggtcgtcgatacc
acaggcgcgggcgacgccttctgcggcgcgctggccgcggcgctcgaccgtggtgccggt
ctcggccgcgcgcttgccgagggcgtcgccgccggcagcctcgcctgcatggcgaccggc
gcccagtccagcgcccccgatgccgcgcgcatcgcggcgctcgccgacaccctcgaagcc
tgctga

DBGET integrated database retrieval system