KEGG   Polymorphum gilvum: SL003B_3685Help
Entry
SL003B_3685       CDS       T01458                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pgv  Polymorphum gilvum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pgv00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3989119..3990435)
Genome map
AA seq 438 aa AA seqDB search
MLAQELIRRKRDGGTLGAEEIAFFVRGLADGSVTEGQVAALAMAVFFRGLTLDERVALTL
AMRDSGTVLDWSDIDAPVLDKHSTGGVGDNVSLMLAPALAACGAAVPMISGRGLGHTGGT
LDKFDSIPGYRTQPDNALFRKVVREVGCAVIGQTGDLAPADRRFYAIRDVTGTVESLDLI
TASILSKKLAAGLQGLVLDVKWGSGAFMAGLDEARALADSLVRVANGAGLKTTALLTDMN
EPLASAAGNAVEMRNAVDFLKGAAVDGRLWDVTVALGGELLVTGGLVGTADEGCARMRDA
FESGRAAEVFARMVAALGGPADFLDRPDAYLASAPVQVPVYPVQPGTVVAVDTRAVGVAV
VELGGGRRTAEDRIDPAVGFTDLAGIGHGVDADAPIAIVHAATPDAARRAGEALRAAYSI
SAARDVPDRPIVAGRVAP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccaggaactcatccgcaggaagcgcgacggcggcacgctcggcgcagaggag
atcgccttcttcgtcaggggccttgccgacggctcggtgaccgagggccaggtcgcagcc
ctcgccatggctgtgttcttccgcggtctgacgctcgacgagcgcgtcgcgctgacgctc
gccatgcgcgacagcggcactgtgctcgactggtccgacattgacgccccggtactcgac
aaacattccaccggcggcgtcggcgacaacgtctcgctgatgctcgctcccgcgctggcc
gcctgcggcgccgcggtgccgatgatctccggccgcggcctcggccacaccggcggcacg
ctcgacaagttcgacagcatccccggctaccggacccagcccgacaacgccttgttccga
aaggtggtcagggaggtcggctgcgccgtcatcggccagaccggcgatctcgctcccgcc
gacaggcgcttctacgccatccgcgacgtcaccggcacggtcgagagcctcgacctcatc
accgcctcgatcctgtccaagaagctcgcggccggtctgcagggccttgtcctcgacgtc
aagtggggctccggtgccttcatggcgggcctggacgaggcgcgtgcgctcgccgacagc
ctggtcagggttgccaacggcgccggcctcaagaccaccgcactgctgaccgacatgaac
gagccgctcgcctcggccgccggcaacgcggtggagatgcgcaacgccgtcgacttcctg
aagggcgccgccgtcgacggccgcctgtgggacgtcacggtggcgctcggtggcgagctg
ctcgtcaccggcggtcttgttggtaccgccgatgagggctgcgcgcgcatgcgcgacgcc
ttcgagagcgggcgtgcggcggaggtcttcgcccgcatggttgccgcgctcggcggtcct
gcggattttctggatcggccggacgcctatctggccagcgcgccggtccaggtgccggtc
tatccggtccagcctggcacggtcgtcgccgtcgacacccgtgcggtcggcgtcgccgtg
gtcgagttggggggcggccggcgaaccgccgaagaccggatcgatccggccgtcggcttc
accgatctggccggaatcgggcacggtgtcgatgccgacgcgccgattgccatcgtgcat
gccgcgaccccggatgctgcccgccgggcgggcgaggccctgcgggcggcctactcgatc
agcgcggcgcgagacgtgccggaccgccccatcgtcgcgggacgtgtcgcgccctga

DBGET integrated database retrieval system