KEGG   Polymorphum gilvum: SL003B_3698Help
Entry
SL003B_3698       CDS       T01458                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pgv  Polymorphum gilvum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_3698 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_3698 (glk)
   00052 Galactose metabolism
    SL003B_3698 (glk)
   00500 Starch and sucrose metabolism
    SL003B_3698 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SL003B_3698 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SL003B_3698 (glk)
   00524 Butirosin and neomycin biosynthesis
    SL003B_3698 (glk)
Enzymes [BR:pgv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SL003B_3698 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4001265..4002311
Genome map
AA seq 348 aa AA seqDB search
MTSQLPARPRAFRFPVLVADVGGTNVRFALVSDTHARAQMIDPRETEAYPDIVAAIRDCV
LDTTSLMPRTAIIAVAGPVTGDRIPLTNASWVVEPLRMIADLGLDEVVVLNDFEAQALAL
PGLVGDDVEQIGGGSPLEGGSKFVLGPGTGLGAAAMIHAAGTWVPVPGEGGHVELGPVSD
EDYRVWPHVERLGGRIGAEQVLSGTGLPRLAHAVAAAEGLARGFATAADVTAAAEQGDPV
AAKTLQVFARALGRVAGDFALTVLARGGVYIAGGVSAYVASFLRTGEFRAAFEAKAPHEA
LVRAIPTFLVRHPNPALAGLAAFARAPSLFAVETAGRRWTTAADGDTA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccagcttcccgctcgtccgcgtgccttccgctttccggtcctcgtcgccgac
gtcggcggaaccaacgtgcgcttcgccctggtttcggacacccatgcgcgcgcgcagatg
atcgatccgcgcgagaccgaggcctatccggacatcgtcgcggcgatccgcgactgcgtt
ctcgatacgacctcgctcatgccgcgtacggccatcatcgcggtggccgggccggtgacc
ggcgaccggatcccgctgaccaatgcctcctgggtggtcgagccgctgcggatgatcgcg
gacctcggactggacgaggtcgtcgtcctgaacgacttcgaggcccaagcgctggcgctg
ccggggcttgtcggcgacgacgtggagcagatcggcggcgggtcgccgctcgaaggcggc
tcgaagttcgtgctcggtcctggcaccggcctcggcgcagcagccatgatccatgccgca
ggcacctgggtgccggtgcccggcgagggcggccatgtcgaacttggaccggtcagcgac
gaagactaccgagtttggccgcatgtcgaacggctgggcggacgcatcggtgccgaacag
gtcctgagcggcaccggcctgccgcggctcgcgcatgccgtggcggcggcggaaggcctg
gcgcgaggcttcgcgacggcggccgacgtgaccgctgcggcagaacagggagatccggtg
gccgccaagactctgcaggtcttcgcccgtgcgctgggacgggtggcaggcgacttcgcc
ctgactgtgctcgctcgcggcggggtctacatcgccggcggcgtctctgcctatgtggcg
tcgttcctgagaaccggggaattccgcgccgcgttcgaggccaaagcgccgcacgaggcg
ctggtcagggcgatcccgaccttcctggtccgccaccccaatcctgcgctggcgggtctg
gccgcctttgcgcgcgcgccgtccctgttcgcggtcgaaacggcgggacgccgctggaca
accgcggcggacggcgacaccgcctga

DBGET integrated database retrieval system