KEGG   Polymorphum gilvum: SL003B_3729Help
Entry
SL003B_3729       CDS       T01458                                 

Definition
(GenBank) M42 glutamyl aminopeptidase superfamily
Organism
pgv  Polymorphum gilvum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4040969..4042018
Genome map
AA seq 349 aa AA seqDB search
MNIDLLRRLCETPGVPGHEHRVRDLIRSEIEGLFDEVSIDPMGSLLCRRAPRKEPKKKGT
APKKVMLLCHMDEIGFLVSHITDKGFVYVQPVGGFDPRNLFSRRVLVSTDAGDLKGVMNP
GGKPVHISTPEERKKVPEVTEFVVDLGFGEATRDKVKIGDMVTLDEPLIEIGDKVVSKAL
DNRIACWLGIESIRALGKAKHACEIHVAFTSQEEVGLRGARTAAYAIKPDIGLGIDTTLA
CDTPGVPDQDRTTVQSAGFGLHVKDSSFIADRALVAEIEAIAQEEKIPYQRTMLLAGGQD
GAAAQQAAAGARAVGIVVGTRYIHTVTEMIHKSDLEAARDIIAAYLKRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaccttctgcgccgcctttgcgagacccccggcgtgcccggccacgagcac
cgggtgcgcgatctgatccgctccgagatcgagggcctgttcgacgaggtcagcatcgac
ccgatgggatcgctgctgtgccggcgcgcgccgcgcaaggagccgaagaagaagggcacg
gcgccgaagaaggtcatgctgctctgccacatggacgagatcggcttcctcgtctcgcac
atcaccgacaagggcttcgtctacgtccagccggtcggcggcttcgacccgcgcaacctg
ttctcgcgccgcgtgctggtgtcgaccgacgcgggcgacctgaagggcgtcatgaatccg
ggcggcaagccggtgcacatctccacgccggaggagcgcaagaaggtgcccgaggtgacc
gagttcgtcgtcgacctcggtttcggcgaggcgaccagggacaaggtgaagatcggcgac
atggtgacgctggacgagccgctgatcgagatcggcgacaaggtggtctccaaggcgctt
gacaaccggatcgcctgctggctcggcatcgagtcgatccgcgcgctcggcaaggccaag
cacgcctgcgagatccacgtcgccttcacgtcccaggaggaggtaggcctgcgcggcgcg
cgcacggcggcctacgcgatcaagccggacatcggcctcggcatcgacaccacgctcgcc
tgcgacacgccgggcgtgcccgaccaggaccgcacgacggtgcagagcgctggcttcggc
ctgcatgtcaaggacagttcgttcatcgccgaccgggcgctggtcgccgaaatcgaggcg
atcgcgcaggaagagaagatcccctaccagcgcaccatgctgctcgccggcggccaggac
ggcgcggcggcgcagcaggcggcggccggcgcccgggcagtcggcatcgtggtcggcacg
cgctacatccacacggtgaccgagatgatccacaagtccgacctggaagccgcgcgcgac
atcatcgcggcctatctgaaacgggcgtga

DBGET integrated database retrieval system