KEGG   Polymorphum gilvum: SL003B_3729Help
Entry
SL003B_3729       CDS       T01458                                 

Definition
(GenBank) M42 glutamyl aminopeptidase superfamily
Organism
pgv  Polymorphum gilvum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18 Dehydratase_MU
Motif
Other DBs
NCBI-ProteinID: ADZ72150
UniProt: F2J3L4
Position
4040969..4042018
Genome map
AA seq 349 aa AA seqDB search
MNIDLLRRLCETPGVPGHEHRVRDLIRSEIEGLFDEVSIDPMGSLLCRRAPRKEPKKKGT
APKKVMLLCHMDEIGFLVSHITDKGFVYVQPVGGFDPRNLFSRRVLVSTDAGDLKGVMNP
GGKPVHISTPEERKKVPEVTEFVVDLGFGEATRDKVKIGDMVTLDEPLIEIGDKVVSKAL
DNRIACWLGIESIRALGKAKHACEIHVAFTSQEEVGLRGARTAAYAIKPDIGLGIDTTLA
CDTPGVPDQDRTTVQSAGFGLHVKDSSFIADRALVAEIEAIAQEEKIPYQRTMLLAGGQD
GAAAQQAAAGARAVGIVVGTRYIHTVTEMIHKSDLEAARDIIAAYLKRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcgaccttctgcgccgcctttgcgagacccccggcgtgcccggccacgagcac
cgggtgcgcgatctgatccgctccgagatcgagggcctgttcgacgaggtcagcatcgac
ccgatgggatcgctgctgtgccggcgcgcgccgcgcaaggagccgaagaagaagggcacg
gcgccgaagaaggtcatgctgctctgccacatggacgagatcggcttcctcgtctcgcac
atcaccgacaagggcttcgtctacgtccagccggtcggcggcttcgacccgcgcaacctg
ttctcgcgccgcgtgctggtgtcgaccgacgcgggcgacctgaagggcgtcatgaatccg
ggcggcaagccggtgcacatctccacgccggaggagcgcaagaaggtgcccgaggtgacc
gagttcgtcgtcgacctcggtttcggcgaggcgaccagggacaaggtgaagatcggcgac
atggtgacgctggacgagccgctgatcgagatcggcgacaaggtggtctccaaggcgctt
gacaaccggatcgcctgctggctcggcatcgagtcgatccgcgcgctcggcaaggccaag
cacgcctgcgagatccacgtcgccttcacgtcccaggaggaggtaggcctgcgcggcgcg
cgcacggcggcctacgcgatcaagccggacatcggcctcggcatcgacaccacgctcgcc
tgcgacacgccgggcgtgcccgaccaggaccgcacgacggtgcagagcgctggcttcggc
ctgcatgtcaaggacagttcgttcatcgccgaccgggcgctggtcgccgaaatcgaggcg
atcgcgcaggaagagaagatcccctaccagcgcaccatgctgctcgccggcggccaggac
ggcgcggcggcgcagcaggcggcggccggcgcccgggcagtcggcatcgtggtcggcacg
cgctacatccacacggtgaccgagatgatccacaagtccgacctggaagccgcgcgcgac
atcatcgcggcctatctgaaacgggcgtga

DBGET integrated database retrieval system