KEGG   Polymorphum gilvum: SL003B_3788Help
Entry
SL003B_3788       CDS       T01458                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pgv  Polymorphum gilvum
Brite
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SL003B_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4097701..4098345
Genome map
AA seq 214 aa AA seqDB search
MQMTDRGLLALVRHEGIVPGPYRDVKQVWTFGIGHTAAAGAPDPAAMPRGMPANLDAGIR
EAFGVSRADLARYEAAVLRAVKVPLKPHEFDALVSFHYNTGGIAKAALTRHLNAGDRVAA
AAAFMGWLKPAAIQARREAERDLFATGRYPAGTIPVWSVDRNGRVDFSRPIRRLTENEAL
ALLRPSTASVPTQSVVAPPWWRRLLDHFKGKATS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgactgaccggggccttctggccctcgtccggcacgaaggcatcgtgcccgga
ccctaccgtgatgtgaaacaggtctggacctttggcattggccacaccgccgctgccggg
gcacccgatccggccgcgatgccgcgcggcatgcccgccaatctagatgcagggatccgc
gaggcttttggggtctcccgcgccgacctcgcgcgttacgaggccgccgtcctgcgcgcc
gtgaaggtgccgctcaagccgcacgagttcgatgcgctggtttcgtttcactacaataca
ggcggcatcgccaaggctgcgctgacccggcacctgaacgcgggcgaccgggttgcagct
gcagcggctttcatgggctggctcaaacccgccgcgatccaagcgcggcgtgaggccgag
cgcgacctcttcgccacgggccgctatcccgccggcaccatcccggtctggtcggtcgac
cgcaacggccgggtcgatttctcgcgaccgatccggcgtctgaccgagaacgaggcgctg
gcgctacttcggccgtcgactgcgtcggtgccgacgcaatccgttgtcgctccgccgtgg
tggcggaggctgttggaccacttcaaaggaaaggcaacatcatga

DBGET integrated database retrieval system