KEGG   Polymorphum gilvum: SL003B_3916Help
Entry
SL003B_3916       CDS       T01458                                 

Definition
cellulase (glycosyl hydrolase family 5)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pgv  Polymorphum gilvum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SL003B_3916
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SL003B_3916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4231699..4232823
Genome map
AA seq 374 aa AA seqDB search
MPRADRRPAPRAMALALALVPALALGSAGAAPARECLRGANAAGGEFGPLPGRHGQTHLY
PSEATLAYLAGKGMNVVRLPFRWERLQPTPFGRLDDTELTLLRASVDTAAALGLTVILDP
HNYARYGEAMIGSQAVPVEAFADFWRRLAPLYAGRDDIVYLLMNEPQSITARAWLPAVNA
AIAAIRAAGADNLILVPGTIWTGASHWFEDQDGGSNAEVLMGVEDPLDHYAFDVHQYMDR
DFSGTNADCPRVADALAALDRVTGWLARTGNRAFLGEFGGTSSPDCLAGIAAMAAFVNAR
PDTWFGWAYWAAGDWWGDYPLSIQPEADGTERPQMAALEPLVARLTAAERACPALEATAG
WQLRGPKEGDNARP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtgctgaccggcgcccggcaccgcgcgccatggcgctcgccctagccctggtt
cccgccctggccctcggttcggccggcgcggcgccggcgcgcgaatgcctgcgcggcgcc
aatgcggcaggcggcgagttcggccccctgccgggacgccacggccagacgcacctctat
ccctccgaggccacgctcgcctacctcgccggcaagggcatgaacgtcgtgcgtctgccg
tttcgctgggaacggctgcagccgaccccgttcggtcggctcgacgacaccgaactgacg
ctgctccgggcgagtgtcgacacggctgccgccctcggcctgacggtcattctcgatccg
cacaactacgccaggtacggcgaggccatgatcggctcccaggcggttccggtcgaggcc
ttcgccgatttctggcgccgcctcgcgccgctctacgccggccgcgacgacatcgtctat
ctgctgatgaacgagccgcaatcgatcaccgcgcgcgcctggctgccggcggtcaacgcg
gccatcgccgccatccgcgccgctggcgccgacaacctgatccttgtgcccggcaccatc
tggaccggcgcctcgcactggttcgaggaccaggacggcggctcgaatgccgaggtcctg
atgggcgtcgaggatccgctcgatcactacgccttcgacgtccaccagtacatggaccgg
gacttttcgggcaccaacgcggactgcccgcgtgtcgccgacgcgctcgccgcactcgac
cgggtcaccggctggctggcccgcaccggcaaccgcgccttcctcggcgagttcggcggc
accagctcgccggactgtctggccggcatcgcggcgatggccgctttcgtcaacgcccgt
cccgacacctggttcggctgggcctactgggcggccggcgactggtggggtgactacccg
ttgtcgatccagccggaggccgatggcacggagcggccccagatggccgcgctcgagccg
ctcgtcgcgcggctgaccgcggcggagcgcgcctgtcccgcactcgaagcgaccgccggc
tggcagttgcgcggcccgaaggagggagacaatgcccgtccgtga

DBGET integrated database retrieval system