KEGG   Polymorphum gilvum: SL003B_4230Help
Entry
SL003B_4230       CDS       T01458                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pgv  Polymorphum gilvum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SL003B_4230 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL003B_4230 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SL003B_4230 (sucB)
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SL003B_4230 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4537887..4539413)
Genome map
AA seq 508 aa AA seqDB search
MATEIRVPTLGESVSEATIAQWFKKPGEAVTADEPLVELETDKVTVEVPAPASGTLESIV
VNEGDTVEVGALLGRIAASGAAKPAAAAPAKKAESAPAAAPAAAKPSAALVDVVVPSAGE
SVTEAGVGGWSVKVGDVVKVDDILVELETDKAAQEVPAPVAGTVVKIAAATGDTVTPGQL
LVQIDPSGAAAPAAAPAPAAAPAPAERTGSAMPPAPSAAKLMAEKGLAADQVAGSGKRGQ
VLKGDVLAAVAAGVSAAPAASAAPAAVRGPVAVEDEAREERVRMTKLRQTIARRLKDAQN
TAAMLTTYNEVDMGPVMELRSAYKDVFEKKHGVKLGFMGFFTKAVCHALKEIPAVNAEID
GTDVIYKNFCHIGVAVGTDKGLVVPVVRDADQMSIAEIEKEIAALGRKARDGKLGMAEMQ
GGTFTISNGGVYGSLMSSPILNAPQSGILGMHKIQDRPMAVNGQVVIRPMMYLALSYDHR
IVDGKEAVTFLVRVKESLEDPRRLVLDL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaatccgcgtgcccaccctgggcgaatccgtatccgaggcgaccatcgcc
cagtggttcaagaagcctggcgaggccgtcaccgccgacgagccgctggtcgagctggag
accgacaaggtgaccgtcgaggtgccggcgccggcttccggaacgctggagagcatcgtg
gtcaacgagggcgacaccgtcgaggtcggcgccctgcttggccgcatcgccgcctccggc
gccgccaagccggctgccgccgccccggcaaagaaggccgaatcggccccggcagcggcc
ccggcagcggccaagccatcggccgcgctggtcgacgtcgtcgtgccgagcgccggtgaa
tccgtcaccgaggccggcgtcggcggctggagcgtcaaggtcggcgacgtggtcaaggtc
gacgacatcctggtcgagctcgaaaccgacaaggcggcccaggaagtgccggctccggtc
gccggcacggtggtgaagatcgccgccgccaccggcgacaccgtcaccccgggccagctg
ctggtccagatcgacccgagcggcgcggccgccccggccgccgccccggcgcctgctgcc
gcgccggccccggccgagcgcaccggctccgccatgccgcccgcgccgtccgccgccaag
ctgatggccgagaagggccttgccgccgaccaggtcgccgggtcgggcaagcgtggccag
gtgctcaagggcgacgtgctcgccgccgtcgcggccggcgtctccgccgctccggctgcg
tccgccgcgcccgccgccgtccgcggcccggtcgcggtcgaggacgaggcgcgcgaggaa
cgcgtgcgcatgaccaagctgcgccagaccatcgcccgccggctgaaggatgcgcagaac
accgccgccatgctgaccacctacaacgaggtcgacatgggtccggtgatggagctgcgc
tcggcctacaaggacgtgttcgagaagaagcacggcgttaagctcggcttcatgggcttc
ttcaccaaggcggtctgccacgcgctgaaggagatcccggcggtcaacgccgagatcgac
ggtaccgacgtcatctacaagaacttctgccacatcggcgtcgccgtcggcaccgacaag
ggcctcgtcgtgccggtcgtgcgcgacgccgaccagatgtcgatcgccgagatcgagaag
gagatcgccgcgctcggccgcaaggcccgcgacggcaagctcggcatggccgagatgcag
ggcggcaccttcaccatctccaacggcggcgtctacggctcgctgatgtcctcgccgatc
ctcaacgcgccgcagtcgggcatcctcggcatgcacaagatccaggaccggccgatggcc
gtcaacggccaggtcgtcatccggccgatgatgtatctcgcgctgtcctacgatcaccgc
atcgtcgacggcaaggaggcggtcaccttcctggtccgcgtcaaggagagccttgaggat
ccgcgccgcctggtgctggacctctga

DBGET integrated database retrieval system