KEGG   Polymorphum gilvum: SL003B_4233Help
Entry
SL003B_4233       CDS       T01458                                 

Gene name
sucC
Definition
(GenBank) ATP-dependent carboxylate-amine ligase-like, ATP-grasp:Succinyl-CoA synthetase, beta subunit:ATP-citrate lyase/succinyl-CoA l
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00020  Citrate cycle (TCA cycle)
pgv00640  Propanoate metabolism
pgv00660  C5-Branched dibasic acid metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
Module
pgv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pgv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL003B_4233 (sucC)
   00640 Propanoate metabolism
    SL003B_4233 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SL003B_4233 (sucC)
Enzymes [BR:pgv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SL003B_4233 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ADZ72650
UniProt: F2IVD2
Position
complement(4543575..4544774)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKAVLKEYGAPVAEGVAIFSADEAAAAARKLPGPLWVVKSQIHAGGRGKGKFK
ELPADAKGGVRLSFSLEDVVKNAREMLGHTLVTAQTGPAGKVVNRLYIEDGADIERELYL
SILVDRSVGRPAFVVSTEGGMDIEAVAEHTPEKIVTVAIDPDTGVTEADAARLCDALELE
GAARADGMTLFPILYKAFMEKDMSLLEINPLIVMKDGRLRVLDAKVSFDGNALFRHPEIV
ALRDITEEDEKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITSDPNVKGILVNIFGGIMRCDVIAEGVLAAVREVGLQVPLVVRLE
GTNVELGKKIIAESGLNVIAADDLDDAAKKIVAAVKGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtatcaggccaaggcggtcctgaaggaatacggcgcgccggtcgcc
gagggcgtcgcgatcttctcggccgacgaggccgcggccgcggcccgcaagctgcctgga
ccgctctgggtcgtgaagtcccagatccacgccggcggccgcggcaagggcaagttcaag
gaactgcccgccgatgccaagggcggtgtccgtctctccttctcgctggaggacgtcgtc
aagaacgccagggaaatgcttgggcataccctggtgaccgcccagaccggcccggccggc
aaggtcgtcaaccgtctctacatcgaggacggcgccgacatcgagcgcgaactctacctg
tcgatcctggtcgaccgctccgttggccgcccggccttcgtcgtctcgaccgagggcggc
atggacatcgaggccgtcgccgaacatacgcccgagaagatcgtcaccgtcgccatcgat
cccgataccggcgtgaccgaggcggatgccgcgaggctgtgcgacgcgctcgagctggag
ggcgccgcccgcgccgatggcatgacgctgttcccgatcctctacaaggcgttcatggaa
aaggacatgagccttctggagatcaacccgctgatcgtcatgaaggacggccgcctgcgc
gtcctcgacgccaaggtctccttcgacggcaacgccctgttccgccatcccgagatcgtc
gccctgcgcgacatcaccgaggaagacgagaaggagatcgaggcctccaagtatgacctc
gcctacgtcgccctcgacggcaacatcggctgcatggtcaacggtgccggccttgccatg
gcgaccatggacatcatcaagctctacggcgccgagccggcgaacttcctcgatgtcggt
ggcggcgcctccaaggaaaaggtcactgcggctttcaagatcatcacgtccgatccgaac
gtgaagggcatcctggtcaacatcttcggcggcatcatgcgctgcgacgtgatcgcggaa
ggcgtgttggccgccgtgcgcgaggtcggcctgcaggtgcccctcgtcgtccgcctggaa
ggcactaacgtcgaactcggcaagaagatcatcgccgaaagcggtctcaacgtgatcgcc
gccgacgacctcgacgacgccgccaagaagattgtcgctgccgtgaagggagccgcctga

DBGET integrated database retrieval system