KEGG   Polymorphum gilvum: SL003B_4292Help
Entry
SL003B_4292       CDS       T01458                                 

Definition
(GenBank) Putative CytoChrome c-like protein
  KO
K08738  cytochrome c
Organism
pgv  Polymorphum gilvum
Pathway
pgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SL003B_4292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ADZ72709
UniProt: F2IVJ1
Position
complement(4606734..4607279)
Genome map
AA seq 181 aa AA seqDB search
MDAFELNKIAGAVLMVLLLTMGVGIVSDVIFTPTIPSKPGYEIVVASAEDATAEGEAVAE
EIPLAERLAAASVEGGERAARKCAACHTFEQGGANKVGPNLWAVVGRKPASVSGFSYSAA
MNAFAETHDAWTLEQLDAFLTNPRAHVPGTSMGFAGLRRTDERSDMIVYMNAQSDNPAPL
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttcgagctgaacaagatcgccggtgcggttttgatggtccttctcctgacg
atgggcgtcggtatcgtctctgacgtgatcttcacgccgactatcccgagcaagccgggc
tatgaaatcgtggtcgccagcgcggaggatgcgacggccgagggcgaagccgttgccgaa
gaaattccgttggccgaacgtcttgccgcggcttccgtcgaaggcggcgagagggctgcg
cgcaagtgcgccgcctgtcacacgttcgaacagggcggcgccaacaaggtcggtccgaac
ctgtgggccgtcgtcggccgcaagcccgcttcggtctccggcttctcctattctgccgcc
atgaacgccttcgccgaaacccacgatgcctggacgcttgagcagctcgatgccttcctg
accaacccgcgcgctcacgtcccgggcacctcgatgggcttcgccggcctgagaaggacg
gacgagcgcagcgacatgatcgtctacatgaacgcccagtcggacaacccggcaccgctg
gagtaa

DBGET integrated database retrieval system