KEGG   Polymorphum gilvum: SL003B_p0057Help
Entry
SL003B_p0057      CDS       T01458                                 

Definition
Acetaldehyde dehydrogenase NahO
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pgv  Polymorphum gilvum
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pgv00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pgv00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:pgv00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:pgv00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:pgv00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSL003B:42365..43276
Genome map
AA seq 303 aa AA seqDB search
MSSKLKAVIIGPGNIGTDLLMKMKRSAWVEPVWMVGIDPSSEGLKRAADMGVKACATGVD
GILEHVIADDIRVAFDATSAYAHAENSRKLNELGVIMVDLTPAAIGPFCIPPVNLADHAK
KLEMNVNMVTCGGQATIPMVAAVSRVQPVEYGEIVAAVSSRSVGPGTRKNIDEFTRTTAA
AIEKVGGAKRGKAIIIVNPAEPPLLMRDTVHVLTEGEPDQAAITESVKAMVAEVRKYVPG
YKLVNGPVFDGRRVSIYLEVEGLGDFLPKYAGNLDIMTAAALRTAELFAQEAANGVVTLP
ARG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaactcaaggcggtcatcatcggccccggcaatatcggtaccgatctcctg
atgaagatgaagcgttccgcatgggtggagccggtctggatggtcggcatcgacccgagc
tcggaggggctgaagcgggcggctgacatgggcgtgaaggcctgtgcaaccggcgtggac
ggcatcctggaacacgtcatcgccgatgatatccgcgtcgccttcgatgccacctcggct
tatgcgcatgcggaaaactcgcgcaagctgaatgaactcggggtcatcatggtggaccta
acgccggcggcgatcgggcccttctgcattccgccggtcaatctcgcggatcacgccaag
aagctcgagatgaacgtgaacatggtcacctgcggcggccaggccaccattccgatggtg
gcggcagtgtcgcgcgtgcaaccggtcgaatatggcgagatcgtcgcggcggtatcgtcg
cgttcggtcggcccaggtacgcgcaagaacatcgacgaattcacccgcacgacggcggcg
gccatcgaaaaggtcggcggcgccaagcgcggcaaggctatcatcatcgtcaatcccgcc
gagccgccgcttctgatgcgcgacacggtgcatgtcctgaccgaaggcgaaccggaccaa
gccgcgatcaccgaaagcgtcaaggccatggtggccgaggtgcggaaatatgtgcccggc
tacaaactggtgaacggtccggtgttcgacggccgccgcgtgtccatctacctcgaggta
gaaggccttggcgacttccttccgaaatatgccggcaatcttgacatcatgacggcggct
gcccttcgcaccgccgaactttttgcccaggaggcggccaatggcgtcgtcaccctgccg
gcgcgcggttga

DBGET integrated database retrieval system