KEGG   Polymorphum gilvum: SL003B_p0057Help
Entry
SL003B_p0057      CDS       T01458                                 

Definition
Acetaldehyde dehydrogenase NahO
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
pgv  Polymorphum gilvum
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SL003B_p0057
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SL003B_p0057
   00650 Butanoate metabolism
    SL003B_p0057
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SL003B_p0057
   00622 Xylene degradation
    SL003B_p0057
   00621 Dioxin degradation
    SL003B_p0057
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SL003B_p0057
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     SL003B_p0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSL003B:42365..43276
Genome map
AA seq 303 aa AA seqDB search
MSSKLKAVIIGPGNIGTDLLMKMKRSAWVEPVWMVGIDPSSEGLKRAADMGVKACATGVD
GILEHVIADDIRVAFDATSAYAHAENSRKLNELGVIMVDLTPAAIGPFCIPPVNLADHAK
KLEMNVNMVTCGGQATIPMVAAVSRVQPVEYGEIVAAVSSRSVGPGTRKNIDEFTRTTAA
AIEKVGGAKRGKAIIIVNPAEPPLLMRDTVHVLTEGEPDQAAITESVKAMVAEVRKYVPG
YKLVNGPVFDGRRVSIYLEVEGLGDFLPKYAGNLDIMTAAALRTAELFAQEAANGVVTLP
ARG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaactcaaggcggtcatcatcggccccggcaatatcggtaccgatctcctg
atgaagatgaagcgttccgcatgggtggagccggtctggatggtcggcatcgacccgagc
tcggaggggctgaagcgggcggctgacatgggcgtgaaggcctgtgcaaccggcgtggac
ggcatcctggaacacgtcatcgccgatgatatccgcgtcgccttcgatgccacctcggct
tatgcgcatgcggaaaactcgcgcaagctgaatgaactcggggtcatcatggtggaccta
acgccggcggcgatcgggcccttctgcattccgccggtcaatctcgcggatcacgccaag
aagctcgagatgaacgtgaacatggtcacctgcggcggccaggccaccattccgatggtg
gcggcagtgtcgcgcgtgcaaccggtcgaatatggcgagatcgtcgcggcggtatcgtcg
cgttcggtcggcccaggtacgcgcaagaacatcgacgaattcacccgcacgacggcggcg
gccatcgaaaaggtcggcggcgccaagcgcggcaaggctatcatcatcgtcaatcccgcc
gagccgccgcttctgatgcgcgacacggtgcatgtcctgaccgaaggcgaaccggaccaa
gccgcgatcaccgaaagcgtcaaggccatggtggccgaggtgcggaaatatgtgcccggc
tacaaactggtgaacggtccggtgttcgacggccgccgcgtgtccatctacctcgaggta
gaaggccttggcgacttccttccgaaatatgccggcaatcttgacatcatgacggcggct
gcccttcgcaccgccgaactttttgcccaggaggcggccaatggcgtcgtcaccctgccg
gcgcgcggttga

DBGET integrated database retrieval system