KEGG   Pseudoalteromonas haloplanktis: PSHAa0062Help
Entry
PSHAa0062         CDS       T00282                                 

Definition
glutathione peroxidase (EC:1.11.1.-)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pha00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pha00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(64576..65067)
Genome map
AA seq 163 aa AA seqDB search
MHKFHQLSATSLQGNTINFSEFAGKVVLIVNTASKCGFTYQYESLQALHNKYASQGLVIL
GFPCNQFNQQEPGDAQQIEQGCLINYGVNFLMAAKVEVNGEHAHPVFRYLKSTQPGFLTR
KIKWNFTKFLIAADGSPIKRYAPFTKPEKLELTIQKALQQSNK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtttcatcagttaagcgccaccagtttgcaaggtaacaccattaattttagc
gagtttgctggtaaagtcgtgcttattgtaaacacggcaagcaagtgtggttttacctac
cagtacgagtcactacaggctttgcataataaatatgctagccaaggcttagtaatttta
ggatttccgtgtaatcagtttaatcagcaagaacccggagatgcacagcagatagagcaa
ggatgtttaataaactacggggttaattttttaatggccgctaaagtagaggtaaacgga
gagcatgctcatccggtatttcgttatttgaaatcgacacaacctggctttttaactcgc
aaaataaagtggaactttactaagtttttaatcgcagcagacggctcaccaattaaacgc
tatgcaccctttaccaagccagaaaagctagagctcaccattcaaaaagcactgcaacaa
agtaataagtaa

DBGET integrated database retrieval system