KEGG   Pseudoalteromonas haloplanktis: PSHAa0074Help
Entry
PSHAa0074         CDS       T00282                                 

Gene name
folM
Definition
short chain dehydrogenase (EC:1.1.-.-)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSHAa0074 (folM)
   00670 One carbon pool by folate
    PSHAa0074 (folM)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PSHAa0074 (folM)
    1.5.1.-  
     PSHAa0074 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(76007..76726)
Genome map
AA seq 239 aa AA seqDB search
MTPPILITGAGQRIGLALAKHFIAQGQPIIITYRTRHAAVDLLEQQGAVCIYADFSTDDG
ISTFIKALKEHTNSLRAILHNASSWDCEANNANFAQLFDNMMRIHAKTPYLINLLCAELL
LNYQTEMNTPADIIHLTDYVVETGSPKHVAYAASKAALDNLTKSFSAKYAPNIKVNSVAP
SLIIFNEHDDEQYRAKTLKKSLMGIEPGCQEIINSIDLLLHSHYITGRAIPVDGGRHLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaccgattttaattacaggtgctgggcaacgcattggccttgctttagctaaa
cattttattgcacaagggcagccgataattattacctatcgtactcgccacgctgcagtt
gatttactggagcagcagggcgctgtatgcatttatgcagactttagtactgatgatggt
attagcacttttattaaagcacttaaagagcataccaactcactacgcgctattttgcat
aatgcttccagttgggactgcgaagctaataacgccaactttgcgcaactgtttgacaat
atgatgcgaattcatgcaaaaacaccttatttaattaatttactgtgtgcagagttatta
ctaaattatcaaactgagatgaatactcccgcagatattattcatcttaccgattacgta
gtagaaacaggtagcccaaaacatgtcgcttatgcagcaagtaaagcagcgcttgataac
ttaacaaagtcgttcagtgctaagtacgcacctaatattaaagtaaattcggttgcacca
tcgttaattatttttaatgagcatgatgatgaacaatatcgtgctaaaacgctgaaaaag
tcattaatgggtatcgaaccaggatgccaagaaataatcaatagtattgatttactatta
catagccactacatcacaggccgcgctatacctgtagatggtggtcggcatttaaagtaa

DBGET integrated database retrieval system