KEGG   Pseudoalteromonas haloplanktis: PSHAa0099Help
Entry
PSHAa0099         CDS       T00282                                 

Gene name
hemDX
Definition
uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSHAa0099 (hemDX)
Enzymes [BR:pha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     PSHAa0099 (hemDX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSHAa0099 (hemDX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:100219..102069
Genome map
AA seq 616 aa AA seqDB search
MLNILITRPQGKGAALAQQLEQAGYQASLFPVLKIEYLTPDSIELSPLTNADKIIFVSQD
AVLALSELKPDINIKAQFYGVGQQTADTIYEVFGVRAAVPKQHDSEGLLALKSLADVDSC
NIVLVKGIGGRPDIAKTLKQRGAFLNNCVVYQRTPIDPEPNNWIDHWQSQNVHGIVITSN
AAVDAIFKNLAAPQRQWLQQCRFYVASERIGAYLQQHQVSSANIHIAAGASDNAMFTCIN
QQGSKMSEQSVPSTVDKAAQKTTNATANNGKATAKSDTLKATDKADNTKQRVSKVGSLAL
IISLIVASGVGFEFYQKLNASKTQSLAVNQLNEQNKLLQQELQALKLAQANLQQTLLTSE
QKVTAAMRESTTKNQQELKAALQQAQQQGSSLNPQEVTSLQRMAEFKLWAENDYQGTSAV
LKRLDALLSDHPGTITVRQAITQDIQTLDAIKPIAVEAIYLQLSSVLKNIDELVFNAVNL
PEEVAKIDDKVLSEDLSDWQQNLKNSWDQFLDGFITIRHREGVAIEPLLSEQQRHLVNQR
VKLYITQAQDALLSKHASVYFAALSEAKRLVAEYFKQDDDVTKMVLKSLSNLEKEQLNFN
PKVNLQSTQQVKEWAK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatatcttgataactcgtccccaaggaaaaggcgcagcccttgcacaacaactt
gagcaagcgggttatcaagcgtctttatttcctgtattaaaaatagagtatttaaccccc
gatagtattgagctcagcccattaactaatgccgataaaattatttttgtgtcgcaagat
gcggttttggcgctgagtgaattaaagccagatattaatataaaagcgcaattttatggg
gttggccaacaaacagccgacactatttatgaggtgtttggcgtgcgagcggctgttcct
aaacagcacgactcagaggggttattagcgcttaaatcgcttgccgatgttgatagctgt
aatattgtattggttaaaggaataggggggcgtcctgatatagctaaaacactaaagcag
cgtggtgcctttttaaataactgcgtagtgtatcagcgtactcccatagaccctgagcct
aacaactggatagaccactggcaaagccagaatgtacacggtatagtcataacaagtaat
gcggcggttgatgctatttttaaaaaccttgctgcaccccaaagacaatggttacaacag
tgccgattttatgtagctagtgagcgtataggcgcttatttacagcagcatcaggtaagt
tcggctaatatacatattgcagcaggagctagcgataacgctatgtttacctgcattaat
cagcaaggtagcaaaatgagcgaacagtcagtaccgtcaacggtagataaagcagcgcaa
aaaacgactaatgcaacagccaacaatggcaaagctacggctaaaagcgatacgcttaaa
gcaactgataaggctgacaatactaagcaacgagtaagtaaagttgggagcttagcactt
attatttcattaattgttgcctctggagttggctttgagttttatcaaaagctcaacgcg
agcaagacgcaaagcttagctgttaatcagttaaatgagcaaaataaattactacaacaa
gagctgcaagcacttaagttagctcaagctaatttgcaacagacactattaacgtctgag
caaaaagtaacagctgcaatgcgcgaaagtactacaaaaaaccagcaagaactaaaggct
gccttacaacaagcgcagcagcaaggctcgtctttaaatccacaagaagttaccagcttg
cagcgcatggctgagtttaagttgtgggccgaaaacgactatcaaggaactagcgctgta
ttaaaacgtttagatgctttacttagcgatcaccccggtactattacagtgcgccaagcc
attacacaagatatacaaaccttagatgccataaaaccaattgccgttgaagctatttat
ttacagcttagtagtgtgctgaaaaatattgatgaattggtatttaatgcggtgaacctg
cctgaagaagtagcaaaaattgatgacaaggtattaagtgaagatcttagcgattggcag
caaaacttaaaaaatagttgggatcaatttttagatggttttattactattcgtcatcgt
gaaggcgttgctatagagccattattaagtgaacaacagcgacacctggtaaatcaaaga
gttaagctttatataacgcaagcgcaagatgcattattgagcaagcacgccagtgtttac
tttgcagcactaagcgaagcaaaacgtttagtggctgaatactttaaacaagatgatgat
gttacaaaaatggttttaaagtcgctgtctaatctagaaaaagagcagctaaactttaac
cctaaagtaaacttacaaagcacgcagcaagttaaggagtgggcaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system