KEGG   Pseudoalteromonas haloplanktis: PSHAa0099Help
Entry
PSHAa0099         CDS       T00282                                 

Gene name
hemDX
Definition
uroporphyrinogen-III synthase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pha00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:100219..102069
Genome map
AA seq 616 aa AA seqDB search
MLNILITRPQGKGAALAQQLEQAGYQASLFPVLKIEYLTPDSIELSPLTNADKIIFVSQD
AVLALSELKPDINIKAQFYGVGQQTADTIYEVFGVRAAVPKQHDSEGLLALKSLADVDSC
NIVLVKGIGGRPDIAKTLKQRGAFLNNCVVYQRTPIDPEPNNWIDHWQSQNVHGIVITSN
AAVDAIFKNLAAPQRQWLQQCRFYVASERIGAYLQQHQVSSANIHIAAGASDNAMFTCIN
QQGSKMSEQSVPSTVDKAAQKTTNATANNGKATAKSDTLKATDKADNTKQRVSKVGSLAL
IISLIVASGVGFEFYQKLNASKTQSLAVNQLNEQNKLLQQELQALKLAQANLQQTLLTSE
QKVTAAMRESTTKNQQELKAALQQAQQQGSSLNPQEVTSLQRMAEFKLWAENDYQGTSAV
LKRLDALLSDHPGTITVRQAITQDIQTLDAIKPIAVEAIYLQLSSVLKNIDELVFNAVNL
PEEVAKIDDKVLSEDLSDWQQNLKNSWDQFLDGFITIRHREGVAIEPLLSEQQRHLVNQR
VKLYITQAQDALLSKHASVYFAALSEAKRLVAEYFKQDDDVTKMVLKSLSNLEKEQLNFN
PKVNLQSTQQVKEWAK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatatcttgataactcgtccccaaggaaaaggcgcagcccttgcacaacaactt
gagcaagcgggttatcaagcgtctttatttcctgtattaaaaatagagtatttaaccccc
gatagtattgagctcagcccattaactaatgccgataaaattatttttgtgtcgcaagat
gcggttttggcgctgagtgaattaaagccagatattaatataaaagcgcaattttatggg
gttggccaacaaacagccgacactatttatgaggtgtttggcgtgcgagcggctgttcct
aaacagcacgactcagaggggttattagcgcttaaatcgcttgccgatgttgatagctgt
aatattgtattggttaaaggaataggggggcgtcctgatatagctaaaacactaaagcag
cgtggtgcctttttaaataactgcgtagtgtatcagcgtactcccatagaccctgagcct
aacaactggatagaccactggcaaagccagaatgtacacggtatagtcataacaagtaat
gcggcggttgatgctatttttaaaaaccttgctgcaccccaaagacaatggttacaacag
tgccgattttatgtagctagtgagcgtataggcgcttatttacagcagcatcaggtaagt
tcggctaatatacatattgcagcaggagctagcgataacgctatgtttacctgcattaat
cagcaaggtagcaaaatgagcgaacagtcagtaccgtcaacggtagataaagcagcgcaa
aaaacgactaatgcaacagccaacaatggcaaagctacggctaaaagcgatacgcttaaa
gcaactgataaggctgacaatactaagcaacgagtaagtaaagttgggagcttagcactt
attatttcattaattgttgcctctggagttggctttgagttttatcaaaagctcaacgcg
agcaagacgcaaagcttagctgttaatcagttaaatgagcaaaataaattactacaacaa
gagctgcaagcacttaagttagctcaagctaatttgcaacagacactattaacgtctgag
caaaaagtaacagctgcaatgcgcgaaagtactacaaaaaaccagcaagaactaaaggct
gccttacaacaagcgcagcagcaaggctcgtctttaaatccacaagaagttaccagcttg
cagcgcatggctgagtttaagttgtgggccgaaaacgactatcaaggaactagcgctgta
ttaaaacgtttagatgctttacttagcgatcaccccggtactattacagtgcgccaagcc
attacacaagatatacaaaccttagatgccataaaaccaattgccgttgaagctatttat
ttacagcttagtagtgtgctgaaaaatattgatgaattggtatttaatgcggtgaacctg
cctgaagaagtagcaaaaattgatgacaaggtattaagtgaagatcttagcgattggcag
caaaacttaaaaaatagttgggatcaatttttagatggttttattactattcgtcatcgt
gaaggcgttgctatagagccattattaagtgaacaacagcgacacctggtaaatcaaaga
gttaagctttatataacgcaagcgcaagatgcattattgagcaagcacgccagtgtttac
tttgcagcactaagcgaagcaaaacgtttagtggctgaatactttaaacaagatgatgat
gttacaaaaatggttttaaagtcgctgtctaatctagaaaaagagcagctaaactttaac
cctaaagtaaacttacaaagcacgcagcaagttaaggagtgggcaaaatga

DBGET integrated database retrieval system