KEGG   Pseudoalteromonas haloplanktis: PSHAa0175Help
Entry
PSHAa0175         CDS       T00282                                 

Gene name
pldA
Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pha00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:pha00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pha00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:pha00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:pha00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(183849..184883)
Genome map
AA seq 344 aa AA seqDB search
MSWRYLIILSTLVSTTVFAEEKPKNNEQNSNIELVKQCILNEVIGGDGKQTLDQLRKKCS
ALEEDKQLTAIDKRKAREAVSQKNRNVITPHKRNYILPISYVSHPNNSSFETFDELTGEK
NDEPLDNLEAKYQLSIKVPLFNDFSDKDQAIFFAFTLQSYWQLYNKESSSPFRETNYEPE
VFWVNYLDPEHVPWGDEMAVVLGISHQSNGNSQPNSRSWNRIYANFIWEKNGFVFNFKPW
YRISESEKETPLDPRGDDNPDIYKYMGYFEFSGAYRLNEHEFSFMTRNNLNSDNRGALQL
DWSFPLWGRVRGYAQYFNGYGESLIDYNADIERIGVGILLTDLL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcgatacttgatcatactttcaacattagttagtactactgtttttgctgaa
gaaaaacctaaaaacaatgagcaaaatagtaatattgagctggtaaaacaatgtatttta
aatgaagtgattggtggagacggcaagcaaacactcgatcagcttcgtaaaaagtgctcc
gctcttgaagaagataagcaacttaccgccatcgataagcgcaaagcacgagaagcagta
agccaaaaaaaccgtaatgttattacgccacataaacgtaactacattttacctatttcg
tatgtatcgcatccgaacaatagctcgtttgaaacattcgacgagctaacaggcgaaaaa
aatgacgagccactcgataacttagaagccaaatatcagctttcaattaaagtgcctcta
ttcaatgacttttcagataaagaccaagctatattttttgcctttacactacagtcatat
tggcagctttataacaaagaaagctcatcaccatttcgtgagaccaactacgagccagag
gttttttgggttaactatttagatccagaacacgttccttggggcgacgaaatggctgtt
gttttgggtatttcgcatcaatctaacggtaatagtcagccaaattcacgttcatggaac
cgtatttacgctaactttatttgggaaaaaaatggctttgtgtttaactttaagccttgg
tatcgtatttcagaaagcgagaaagaaacacctttagatccaagaggcgacgacaaccct
gacatttacaaatacatgggttactttgagtttagcggtgcgtatcgccttaatgaacat
gaatttagctttatgacccgtaacaacttaaattcagacaatcgcggtgcattacagctc
gattggtcatttccgctttggggccgagtgcgtggttatgcacagtactttaatggctat
ggcgaaagcttaattgattataacgctgatatagaaagaattggcgtaggtatactactt
accgatttactttaa

DBGET integrated database retrieval system