KEGG   Pseudoalteromonas haloplanktis: PSHAa0515Help
Entry
PSHAa0515         CDS       T00282                                 

Gene name
dsbC
Definition
disulfide bond isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pha  Pseudoalteromonas haloplanktis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:528904..529605
Genome map
AA seq 233 aa AA seqDB search
MLCTSLSAVANDVAVAPNANDPIVIKFAALGVTVKQINPSPVAGLKELITNQGVLYASPD
GQFLMQGTLIDLNNRSNLTEKALNGVRQAGLKEYEDSMIVYKAPNEKHSITVFTDISCGY
CRKLHRELDDLLEAGITVKYLAFPRGGLQGSGYNDLMNVWCAKDQQEALTEAKSGSNTTA
VKGCSAPVAEHYQLGQSFGVTGTPAIILEDGTMIPGYQPAAALSAALNASKAP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgttatgcactagtttaagtgccgtagcgaatgatgtggctgtagcccctaacgctaat
gatcctattgttattaaatttgccgcgcttggtgttaccgttaagcaaataaacccaagc
ccagtagcaggtttaaaagaactgatcactaatcaaggtgtgctttatgcaagcccagac
ggacagtttttaatgcaagggacacttatagacttaaataatcgtagtaatttaaccgaa
aaagcactaaatggcgtgcgccaagctgggttaaaagaatacgaagattcgatgatagtg
tacaaagcacctaacgaaaaacatagcattaccgtatttaccgacattagctgtggttat
tgtcgtaaattacaccgtgagctagatgatttacttgaagcgggtattaccgttaagtat
ttagcgtttccgcgcggtgggctacaaggttcaggttataatgacttaatgaacgtatgg
tgtgctaaagatcaacaagaagcactaaccgaagctaaaagtggctcaaatactacagca
gttaaaggttgtagtgcgccagttgctgagcattatcagctaggtcaaagctttggtgtt
accggtacacctgctattattttagaagatggcaccatgatcccaggctatcagccagct
gccgcattaagcgctgcgcttaacgctagtaaagccccatag

DBGET integrated database retrieval system