KEGG   Pseudoalteromonas haloplanktis: PSHAa0563Help
Entry
PSHAa0563         CDS       T00282                                 

Gene name
ubiH
Definition
2-octaprenyl-6-methoxyphenol hydroxylase (EC:1.14.13.-)
Orthology
K03185  
2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PSHAa0563 (ubiH)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     PSHAa0563 (ubiH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:583881..585071
Genome map
AA seq 396 aa AA seqDB search
MPKQFDVVVIGGGLAGASCALSVAKINPALSIAVVEANEVSNDYHPSFDDRSIALAQQSV
EYLQGLNLFALNSPYATAIKKVSVSDRHHFGKADINCEEFAKDALGYVVEVNPFGRSLHQ
LLNAQINISLYCPDSVSAIEQQLHNNIVTLQSGEQIAAKLLVIADGAQSPTRSLFGLKFN
TQAYKQGAIIANIEVAGGHNNHAFERFTQHGPMALLPMSNNRYSLVWCMQQQHVEQHMAQ
SEDDFISALQSAFGYRGGQFTKVGMRANYPLVYGQVESLIAHRTVVIGNAAHAIHPIAGQ
GFNLGLRDVQVLSNLISQSPNDLGSYAFTREYAQQRSADINNVMTLTDGLVRLFSNSSRI
LALGRSIGLFSMDLFPSLKAPLAKQLMGQVKQGQGL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagcagtttgatgttgttgttattggtggcggtttagccggtgctagctgtgcg
ttaagtgtggctaaaataaatcccgcgcttagtattgctgttgttgaggcgaatgaagta
agtaatgactatcacccgagctttgatgatagaagcatagcacttgctcagcagtcggta
gagtacttgcaaggcttaaatttatttgcgttaaattcaccgtacgctacagcaattaaa
aaagtaagtgtgtctgatcgtcaccattttggtaaagcagatattaactgtgaagagttt
gctaaagatgcccttggttatgtggttgaagtaaacccgtttggccgctcgttacatcaa
ttattaaacgctcaaataaatatcagtttatattgccctgatagcgtaagtgccattgag
cagcaattacataataatatagttactttgcaaagtggcgagcaaatagccgccaagctg
ttagttattgccgacggtgcacagtcgccaactcgcagcttatttggacttaagtttaac
actcaagcttataagcaaggggctattattgccaatatagaagtagctggtgggcataat
aaccatgcttttgagcgatttacgcaacatggccccatggcgctattacctatgagcaac
aaccgctattcactggtgtggtgtatgcagcaacagcacgttgagcagcacatggcacaa
agtgaagacgactttataagcgcactacaaagtgcctttggttatcgcggtggtcaattt
actaaagtgggtatgcgtgctaattaccccttagtgtatggccaagtagaatcgcttatt
gcacaccgcacggtagtaataggtaatgctgcgcatgcaattcatcccattgcagggcaa
gggtttaatctaggcctgcgagatgtacaagtacttagtaacttaatttcccagagccca
aatgacttaggcagttatgcatttactcgcgagtatgcacagcagcgcagcgctgatata
aataacgtgatgaccctaacagatggtttagtaaggcttttttcaaattcatcacgcata
ctggcacttggccgtagtattgggttgttttcgatggatttattcccctctttaaaagcg
ccattagctaagcagttaatggggcaagttaaacaaggtcaaggtttatga

DBGET integrated database retrieval system