KEGG   Pseudoalteromonas haloplanktis: PSHAa0563Help
Entry
PSHAa0563         CDS       T00282                                 

Gene name
ubiH
Definition
2-octaprenyl-6-methoxyphenol hydroxylase (EC:1.14.13.-)
Orthology
K03185  
2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:pha00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:583881..585071
Genome map
AA seq 396 aa AA seqDB search
MPKQFDVVVIGGGLAGASCALSVAKINPALSIAVVEANEVSNDYHPSFDDRSIALAQQSV
EYLQGLNLFALNSPYATAIKKVSVSDRHHFGKADINCEEFAKDALGYVVEVNPFGRSLHQ
LLNAQINISLYCPDSVSAIEQQLHNNIVTLQSGEQIAAKLLVIADGAQSPTRSLFGLKFN
TQAYKQGAIIANIEVAGGHNNHAFERFTQHGPMALLPMSNNRYSLVWCMQQQHVEQHMAQ
SEDDFISALQSAFGYRGGQFTKVGMRANYPLVYGQVESLIAHRTVVIGNAAHAIHPIAGQ
GFNLGLRDVQVLSNLISQSPNDLGSYAFTREYAQQRSADINNVMTLTDGLVRLFSNSSRI
LALGRSIGLFSMDLFPSLKAPLAKQLMGQVKQGQGL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagcagtttgatgttgttgttattggtggcggtttagccggtgctagctgtgcg
ttaagtgtggctaaaataaatcccgcgcttagtattgctgttgttgaggcgaatgaagta
agtaatgactatcacccgagctttgatgatagaagcatagcacttgctcagcagtcggta
gagtacttgcaaggcttaaatttatttgcgttaaattcaccgtacgctacagcaattaaa
aaagtaagtgtgtctgatcgtcaccattttggtaaagcagatattaactgtgaagagttt
gctaaagatgcccttggttatgtggttgaagtaaacccgtttggccgctcgttacatcaa
ttattaaacgctcaaataaatatcagtttatattgccctgatagcgtaagtgccattgag
cagcaattacataataatatagttactttgcaaagtggcgagcaaatagccgccaagctg
ttagttattgccgacggtgcacagtcgccaactcgcagcttatttggacttaagtttaac
actcaagcttataagcaaggggctattattgccaatatagaagtagctggtgggcataat
aaccatgcttttgagcgatttacgcaacatggccccatggcgctattacctatgagcaac
aaccgctattcactggtgtggtgtatgcagcaacagcacgttgagcagcacatggcacaa
agtgaagacgactttataagcgcactacaaagtgcctttggttatcgcggtggtcaattt
actaaagtgggtatgcgtgctaattaccccttagtgtatggccaagtagaatcgcttatt
gcacaccgcacggtagtaataggtaatgctgcgcatgcaattcatcccattgcagggcaa
gggtttaatctaggcctgcgagatgtacaagtacttagtaacttaatttcccagagccca
aatgacttaggcagttatgcatttactcgcgagtatgcacagcagcgcagcgctgatata
aataacgtgatgaccctaacagatggtttagtaaggcttttttcaaattcatcacgcata
ctggcacttggccgtagtattgggttgttttcgatggatttattcccctctttaaaagcg
ccattagctaagcagttaatggggcaagttaaacaaggtcaaggtttatga

DBGET integrated database retrieval system