KEGG   Pseudoalteromonas haloplanktis: PSHAa0563Help
Entry
PSHAa0563         CDS       T00282                                 

Gene name
ubiH
Definition
(GenBank) 2-octaprenyl-6-methoxyphenol hydroxylase
  KO
K03185  2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00130  Ubiquinone and other terpenoid-quinone biosynthesis
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
Module
pha_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    PSHAa0563 (ubiH)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     PSHAa0563 (ubiH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 Lycopene_cycl Pyr_redox_2 GIDA DAO SE FAD_binding_2 HI0933_like Thi4 Trp_halogenase Mqo NAD_binding_8 GILT FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CAI85650
UniProt: Q3ILI3
Position
I:583881..585071
Genome map
AA seq 396 aa AA seqDB search
MPKQFDVVVIGGGLAGASCALSVAKINPALSIAVVEANEVSNDYHPSFDDRSIALAQQSV
EYLQGLNLFALNSPYATAIKKVSVSDRHHFGKADINCEEFAKDALGYVVEVNPFGRSLHQ
LLNAQINISLYCPDSVSAIEQQLHNNIVTLQSGEQIAAKLLVIADGAQSPTRSLFGLKFN
TQAYKQGAIIANIEVAGGHNNHAFERFTQHGPMALLPMSNNRYSLVWCMQQQHVEQHMAQ
SEDDFISALQSAFGYRGGQFTKVGMRANYPLVYGQVESLIAHRTVVIGNAAHAIHPIAGQ
GFNLGLRDVQVLSNLISQSPNDLGSYAFTREYAQQRSADINNVMTLTDGLVRLFSNSSRI
LALGRSIGLFSMDLFPSLKAPLAKQLMGQVKQGQGL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaagcagtttgatgttgttgttattggtggcggtttagccggtgctagctgtgcg
ttaagtgtggctaaaataaatcccgcgcttagtattgctgttgttgaggcgaatgaagta
agtaatgactatcacccgagctttgatgatagaagcatagcacttgctcagcagtcggta
gagtacttgcaaggcttaaatttatttgcgttaaattcaccgtacgctacagcaattaaa
aaagtaagtgtgtctgatcgtcaccattttggtaaagcagatattaactgtgaagagttt
gctaaagatgcccttggttatgtggttgaagtaaacccgtttggccgctcgttacatcaa
ttattaaacgctcaaataaatatcagtttatattgccctgatagcgtaagtgccattgag
cagcaattacataataatatagttactttgcaaagtggcgagcaaatagccgccaagctg
ttagttattgccgacggtgcacagtcgccaactcgcagcttatttggacttaagtttaac
actcaagcttataagcaaggggctattattgccaatatagaagtagctggtgggcataat
aaccatgcttttgagcgatttacgcaacatggccccatggcgctattacctatgagcaac
aaccgctattcactggtgtggtgtatgcagcaacagcacgttgagcagcacatggcacaa
agtgaagacgactttataagcgcactacaaagtgcctttggttatcgcggtggtcaattt
actaaagtgggtatgcgtgctaattaccccttagtgtatggccaagtagaatcgcttatt
gcacaccgcacggtagtaataggtaatgctgcgcatgcaattcatcccattgcagggcaa
gggtttaatctaggcctgcgagatgtacaagtacttagtaacttaatttcccagagccca
aatgacttaggcagttatgcatttactcgcgagtatgcacagcagcgcagcgctgatata
aataacgtgatgaccctaacagatggtttagtaaggcttttttcaaattcatcacgcata
ctggcacttggccgtagtattgggttgttttcgatggatttattcccctctttaaaagcg
ccattagctaagcagttaatggggcaagttaaacaaggtcaaggtttatga

DBGET integrated database retrieval system