KEGG   Pseudoalteromonas haloplanktis: PSHAa0750Help
Entry
PSHAa0750         CDS       T00282                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSHAa0750 (galU)
   00052 Galactose metabolism
    PSHAa0750 (galU)
   00500 Starch and sucrose metabolism
    PSHAa0750 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSHAa0750 (galU)
Enzymes [BR:pha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSHAa0750 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:785388..786266
Genome map
AA seq 292 aa AA seqDB search
MKAVIPVAGLGTRMLPATKAIPKEMLPVVDRPLIQYVVNEAVAAGIKEIVLVTHSSKNSI
ENHFDTSFELEATLEKRVKRQLLAEIQSICPKDVTIIQVRQGEAKGLGHAINCAAPIIGN
EPFVVILPDVIIDDMESDLSKDNLAEMISRFEQTQHSQIMVEPVPMAEVDQFGVVDLGSV
ELKQGESSPIHNMVEKPPVNEAPSNLAVVGRYVLSKNIWPLLAKTPQGAGNEIQLTDAIA
MLMQHETVDAYAIKGRSHDCGSKIGYLKATIEFALRREEFADELKTFIKTLI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgatccccgtagcgggcctcggaacacgcatgttaccagccaccaaagca
attccaaaagaaatgctgccggttgttgaccgtccactaattcagtacgtagttaacgaa
gccgttgccgcaggtattaaagaaatagtactggtaacgcattcaagtaaaaactcaatc
gaaaaccacttcgacaccagttttgagcttgaagccacactagaaaaacgagtaaaacga
cagctacttgccgaaatacagtctatttgtcctaaagatgtaaccattattcaagtacgc
caaggcgaggccaaaggcctagggcatgcaattaactgtgcagcgccaattataggtaac
gaaccatttgtggttattttacccgatgtaataattgatgatatggaaagcgatcttagt
aaagataacttggccgaaatgatcagccgctttgagcaaactcaacatagccaaataatg
gtagagccagttccaatggctgaagttgatcaatttggtgttgttgacttaggcagtgtt
gagctaaaacaaggcgaaagttcgccaattcataacatggtagaaaagccaccagttaac
gaagcaccatcaaaccttgcagtagtagggcgctatgtattaagtaaaaatatttggcca
ttactcgctaaaaccccgcaaggagctggtaacgaaattcagcttactgacgctattgcc
atgctaatgcagcacgaaactgttgatgcatacgcaattaaagggcgcagccacgattgt
ggtagtaaaattggttatcttaaagcaactattgagtttgcactgcgtcgtgaagaattt
gctgacgagttaaaaacgtttattaaaacattaatttaa

DBGET integrated database retrieval system