KEGG   Pseudoalteromonas haloplanktis: PSHAa0873Help
Entry
PSHAa0873         CDS       T00282                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSHAa0873 (tpiA)
   01230 Biosynthesis of amino acids
    PSHAa0873 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSHAa0873 (tpiA)
   00051 Fructose and mannose metabolism
    PSHAa0873 (tpiA)
   00562 Inositol phosphate metabolism
    PSHAa0873 (tpiA)
Enzymes [BR:pha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSHAa0873 (tpiA)
Exosome [BR:pha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSHAa0873 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSHAa0873 (tpiA)
  Exosomal proteins of melanoma cells
   PSHAa0873 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:900091..900840
Genome map
AA seq 249 aa AA seqDB search
MAARKAMVAGNWKMNGSLELVKQMSDAINNVKSNEIDIVLFPPFPLVSAMIASGVSTGTQ
TVSENTPGAFTGEVDAQLIKELGAQYVLVGHSERRSIYKESNDVVAAKFARAQQVGLTPI
LCVGESESEQENGKTEQIVAAQIDAVIEKLGVAALKDSVIAYEPVWAIGTGKTASPEQAQ
SVHKFIRDKIASLNSDLAQGLTILYGGSVNEKNSELLFAQTDIDGGLIGGASLKADSFTA
ICNSAKGTV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacgcaaggcgatggtcgcaggcaattggaaaatgaatggctctttagagctg
gttaaacaaatgtctgatgctattaacaatgttaaatcaaacgagatagacattgtttta
tttcctccgtttccgttagtgtcagcaatgatagccagcggtgtttcaacgggaactcaa
actgtgtcagaaaatacccccggtgcatttaccggtgaagttgatgcacaacttattaaa
gagttgggcgcccaatatgtattagtaggtcactcagagcgccgtagtatatacaaagaa
agtaatgatgtcgtagctgcaaaatttgctcgcgcacaacaagttggtttaacgccaatt
ttatgtgttggagagagcgaaagtgagcaagaaaacggtaaaacagaacaaatagttgct
gcacaaattgatgcagtaattgaaaaattaggtgtagcagcactcaaagattctgtgata
gcatatgaacccgtttgggccataggcacaggtaagactgcatcgccagaacaggcacaa
agcgttcataaatttatccgtgacaaaatcgcttcattaaacagcgatttagcacaaggg
ctaaccatcttatatggtggtagcgttaacgaaaaaaatagcgaattattatttgcacaa
acagatatagacggcggcctaattggtggcgcaagtttaaaagcagattcatttactgct
atctgcaacagtgcaaaagggaccgtataa

DBGET integrated database retrieval system