KEGG   Pseudoalteromonas haloplanktis: PSHAa0903Help
Entry
PSHAa0903         CDS       T00282                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PSHAa0903
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSHAa0903
   00650 Butanoate metabolism
    PSHAa0903
  Lipid metabolism
   00071 Fatty acid degradation
    PSHAa0903
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSHAa0903
   00310 Lysine degradation
    PSHAa0903
   00360 Phenylalanine metabolism
    PSHAa0903
   00380 Tryptophan metabolism
    PSHAa0903
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSHAa0903
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSHAa0903
   00281 Geraniol degradation
    PSHAa0903
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSHAa0903
   00627 Aminobenzoate degradation
    PSHAa0903
   00930 Caprolactam degradation
    PSHAa0903
Enzymes [BR:pha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSHAa0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:932854..933723
Genome map
AA seq 289 aa AA seqDB search
MSEVQTIDDVVLYEVRAQVAVITMDRPEYNNAQNSQMTYALDKAFQLACNDDEVKVIVLA
GNGKHFSAGHDIGTPGRDVDKSFDRTNLFYDHANKPGGEFLYAREHEVYLGMCRRWRDLP
KPTIAMVQGACVAGGLMLAWVCDLIIADDKAFFSDPVVRMGIPGVEYFAHVHELNPRIAK
EFLFTGDRMSADRAYQMGMVNRVVPRDNLEETTFTLANQIAQMPRLGLQLTKQVINNAED
LMGKRSTMDMAFGLHHFAHAHNETISGDRLGGFDAKAMAQANKSAAKEK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagttcaaacaatagatgacgtagtgttatacgaagtgcgcgctcaagtggcg
gttattaccatggatcgccctgaatataacaacgcgcaaaactcgcaaatgacctacgcg
ctagataaggcttttcagcttgcgtgtaacgacgacgaagtaaaagtaattgtacttgcc
ggtaacggcaagcacttttctgctggtcatgacattggcacccctgggcgcgatgttgat
aaaagctttgatcgtactaaccttttttacgatcacgctaataagcccggcggtgagttt
ttatatgctcgcgagcacgaagtgtatttaggaatgtgtcgtcgctggcgcgatttgcct
aagccaacgattgctatggtacaaggtgcctgtgtggctggtggcttaatgctggcgtgg
gtatgtgatttaattattgccgatgacaaagcatttttctctgatccggtcgtgcgcatg
ggtattcctggggttgagtattttgcgcatgtgcacgagcttaatccacgtattgccaaa
gagtttttatttaccggcgatcgtatgtcggcagaccgtgcttatcaaatgggcatggtg
aatcgcgtagtgccaagggataatttagaagagacgacctttactttagctaatcagatt
gcacaaatgccacgactgggtttgcaattaactaagcaagtaattaataacgccgaagat
ttaatgggtaaacgttcaaccatggatatggcgtttggtttgcatcattttgcgcatgcg
cataacgaaacaatatcgggtgaccgcttaggtggctttgacgcgaaagcgatggctcaa
gccaataaatcagcagccaaggaaaaataa

DBGET integrated database retrieval system