KEGG   Pseudoalteromonas haloplanktis: PSHAa0905Help
Entry
PSHAa0905         CDS       T00282                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00071  Fatty acid degradation
pha00280  Valine, leucine and isoleucine degradation
pha00281  Geraniol degradation
pha00310  Lysine degradation
pha00360  Phenylalanine metabolism
pha00362  Benzoate degradation
pha00380  Tryptophan metabolism
pha00410  beta-Alanine metabolism
pha00627  Aminobenzoate degradation
pha00640  Propanoate metabolism
pha00650  Butanoate metabolism
pha00903  Limonene and pinene degradation
pha00930  Caprolactam degradation
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
pha01212  Fatty acid metabolism
Module
pha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSHAa0905
   00650 Butanoate metabolism
    PSHAa0905
  Lipid metabolism
   00071 Fatty acid degradation
    PSHAa0905
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSHAa0905
   00310 Lysine degradation
    PSHAa0905
   00360 Phenylalanine metabolism
    PSHAa0905
   00380 Tryptophan metabolism
    PSHAa0905
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSHAa0905
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSHAa0905
   00281 Geraniol degradation
    PSHAa0905
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSHAa0905
   00627 Aminobenzoate degradation
    PSHAa0905
   00930 Caprolactam degradation
    PSHAa0905
Enzymes [BR:pha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSHAa0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAI85985
UniProt: Q3IE96
Position
I:934845..935597
Genome map
AA seq 250 aa AA seqDB search
MNPAFKSHIENGIAEIIINKAPVNALDSAEWQALADLINSIGQNLAARVLIIRSEGRGFC
AGVDIKELDKYPERIVSVNAGNYETFKAVHLCPIPVIVALHGYVLGGGIGITGAADIVVA
SECTTFALPEVDRGAMGGGAHLQRLFPVQKVRYLFFTGETISAQDADRYGFIERIVPKEQ
LRDTALEIASKIAAKSSDMIRIAKESLNGIEDGDLEAKYRWEQGFTLQAYTSPDSAETRR
AFVDKREANF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcatttaaaagccatatcgaaaacggtatcgccgaaataattataaataaa
gcaccggtaaatgcactcgacagtgctgaatggcaagcgctcgccgatctgatcaacagt
attggccaaaatttggctgctcgggtattaattattcgctcagaagggcgtggtttttgt
gccggtgttgatattaaagagttagataaatacccagagcgtattgttagcgttaacgcc
ggtaattacgaaacgtttaaagcggtacatttgtgtccaataccagtaatagttgcgctg
catggttatgtgctgggtggcggtattggtattactggtgcggccgatattgtggtggcg
tcagaatgtaccacttttgcgctaccagaagtagatcgtggcgctatgggcggcggcgcg
catttacagcgcttatttccggtgcaaaaagtacgttacttgttttttactggcgaaact
atttcggcacaagatgccgatagatacggctttattgaacgcattgtacctaaagagcaa
ttacgcgataccgcgctggaaattgccagcaaaattgccgcaaaaagctccgatatgatc
cgcattgctaaagaaagcctaaatggtattgaagacggtgacctagaagctaaataccgt
tgggagcaagggtttacgctgcaagcttataccagcccagattctgctgaaacccgccgc
gcgtttgtagacaaacgcgaagcgaatttttga

DBGET integrated database retrieval system