KEGG   Pseudoalteromonas haloplanktis: PSHAa0908Help
Entry
PSHAa0908         CDS       T00282                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSHAa0908
   00630 Glyoxylate and dicarboxylate metabolism
    PSHAa0908
   00640 Propanoate metabolism
    PSHAa0908
   00650 Butanoate metabolism
    PSHAa0908
  Lipid metabolism
   00071 Fatty acid degradation
    PSHAa0908
   00072 Synthesis and degradation of ketone bodies
    PSHAa0908
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSHAa0908
   00310 Lysine degradation
    PSHAa0908
   00380 Tryptophan metabolism
    PSHAa0908
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSHAa0908
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSHAa0908
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSHAa0908
Enzymes [BR:pha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSHAa0908
Exosome [BR:pha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSHAa0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:937842..938993
Genome map
AA seq 383 aa AA seqDB search
MTHAYIVDALRTPTGRRKGGLAHVHAIDLGAAVLKPLVERNNIPAEDYDDVIFGCVDTIG
SQAGNIARTSWLAAGLAMNVPGTTVDRQCGSSQQAVHFAAQAIMSGTQDVIAVGGVQTMT
QIPISSAMLAGQPLGFSTPFAESKLWHARFGDAPVNQFYAAQRIAEHWGISRADMEVFAL
ESHRRALAAAAEGRFDREIVAIEGLTFDETPRESSLAKMAELEPVDPTYPSITAAVSSSV
CDASAAMLIVSERALKKYNLTPRARIHHVSVLGDDPIWHLRAPIPATIAALKKANLTLDD
IDLVEINEAFASVVMAWLKETGYSHEKTNVNGGAIALGHPLGATGVRLMTGLLHELERTG
GRYGLQTMCEGGGLANVTIIERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgcatatattgtagacgcactgcgtacacctacaggcagacgcaaagggggc
cttgcccatgtgcatgccatagacttaggtgcagcagtattaaaacctttggttgagcgc
aataacataccagcagaagattacgatgatgtgatttttggctgtgtagacacgataggc
tcgcaagcaggaaacattgcccgcaccagttggttagcggcgggactagcaatgaatgta
ccgggtacaacggttgatagacaatgtggctcatcgcaacaagccgtgcattttgctgcg
caagcgattatgagcggcacgcaagatgtgatagcggtagggggcgtgcaaacaatgacg
caaattcctatttcgtcagcaatgcttgccgggcaaccacttggctttagtacgccattt
gcagagagtaaattgtggcatgcccgctttggcgatgcgccggtaaatcagttttatgcc
gctcagcgcattgctgaacattggggtataagccgcgccgatatggaagtgtttgcgcta
gaaagtcatcgccgtgcattagcagccgcagcagagggacgctttgatcgcgaaatagtg
gcgattgaagggttaacatttgatgaaacacctagagaaagtagtttggctaaaatggca
gaacttgagccggttgaccctacttacccaagtattaccgcagcggtttcgagctcagtg
tgcgatgcatcagcagcaatgcttattgtgtctgagcgcgcattaaaaaaatataacctg
accccaagagcgcgtattcatcatgttagtgtgctgggagatgatcctatttggcacctt
agagcacctattccagctactattgcggcattaaaaaaagcgaatcttacgcttgatgat
attgatttagtagaaattaatgaagcgtttgcctctgtagtaatggcatggctaaaagaa
accggttacagccatgaaaaaactaatgttaatggtggtgccattgcactgggccacccc
cttggcgctaccggcgtgcgcttaatgaccggattattacatgaattagagcgtacaggc
gggcgttatggcctacaaacaatgtgcgaaggcggcggtttagccaatgtcactatcatt
gaacgattataa

DBGET integrated database retrieval system