KEGG   Pseudoalteromonas haloplanktis: PSHAa1288Help
Entry
PSHAa1288         CDS       T00282                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSHAa1288 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSHAa1288 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSHAa1288 (trpA)
Enzymes [BR:pha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSHAa1288 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1345394..1346215)
Genome map
AA seq 273 aa AA seqDB search
MSQVKTDRYGKMFAALNEQKHGAFVPFVTIGDPGKEQSIAIIKSLIDGGADALELGIPFS
DPIADGPVIQKANIRALNVHINTQDCFDIIKQIRQYNADIPIGLLLYSNLVFKRGIDTFY
KDAKAAGVDSILVADVPLHESKTFRKAAMANGVDPIFIATPNADDDTLRACASYGRGYTY
LLSRAGVTGTDEKAQMPAGNIVTKLKEYHSAPALLGFGISTSDDVKAALNAGAAGAISGS
AVVKIIEANLDDLPTMTTQLKAFVTKMKAATAL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtaaaaacagatcgctacggtaaaatgtttgcagccctaaatgagcaaaaa
cacggggcatttgtaccctttgtaactattggcgaccccggtaaagagcaaagtattgct
attattaaaagtttaattgatggcggcgccgacgccctagagttaggtattccgttttca
gatccaattgctgatggaccagtcattcaaaaagcaaatattcgcgcccttaatgtacac
attaacacccaagactgctttgatattattaaacaaatacgccagtacaatgcagatatt
ccaattggtttattactgtattcaaacttagtttttaagcgcggtatagacaccttttat
aaagatgctaaagccgccggcgtagactctattttagtggccgatgtgccactgcatgag
tcaaaaacatttagaaaggcagccatggcaaacggtgtagaccctatctttattgccacc
cctaatgctgatgacgacacgcttcgtgcatgcgcatcgtatggcagaggttacacctat
ttactatcgcgtgcgggagttaccggcactgacgaaaaagcgcaaatgccagcgggcaac
attgtaactaaattaaaagaataccatagcgcaccagcactattaggttttggtatttca
acgtctgatgatgtaaaagccgcattaaatgccggtgctgcgggggctatttcgggctcg
gcagtggttaaaattatcgaagcaaaccttgatgatttacccaccatgaccacacaatta
aaagcctttgtaactaaaatgaaagctgctacagcgctttaa

DBGET integrated database retrieval system