KEGG   Pseudoalteromonas haloplanktis: PSHAa1289Help
Entry
PSHAa1289         CDS       T00282                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta protein (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSHAa1289 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSHAa1289 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSHAa1289 (trpB)
Enzymes [BR:pha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSHAa1289 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1346212..1347396)
Genome map
AA seq 394 aa AA seqDB search
MKNPAYFGEFGGMFVPELLVPALKQLENEFNKAQKDPQFQAELSKLLNEYAGRPTPLTLT
RNLIKNPKVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKTEVIAETGAGQHGVATALA
CALLGLKCRIYMGAKDVERQQPNVFRMELMGATVIPVTAGSGTLKDAVNEALRDWSANYQ
DAHYLLGTAAGPHPFPTIVREYQKIIGEEAKQQVLKAEGRLPDAVIACVGGGSNAIGMFS
DFINEPSVKLIGVEPAGKGLDTHEHGATICKGTKGILHGTYTYIMQNDDGQIEESYSVSA
GLDYPAVGPQHAFLHETGRAQYVAITDTEALDAFQSLAKNEGIIPALESSHALAYALKYA
EALTDESIIVVNLSGRGDKDLAHVHNVLSQGGQI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccagcttattttggcgagtttggcggtatgtttgtacccgagctacttgtc
cctgcgcttaagcagttagaaaacgaatttaacaaagcacaaaaagatccacagtttcag
gctgagctttcaaaattacttaacgagtatgcgggtcgccctacgccacttactttaacg
cgtaatttaattaaaaacccaaaggttaaactgtatttaaagcgtgaagatttactgcac
ggtggcgcgcacaaaactaaccaagtacttggccaagcgttattaactaaacgtatgggt
aaaacagaggttattgccgaaacaggtgcaggccaacatggtgttgctacagcacttgct
tgtgctctgctgggtttaaaatgccgtatttacatgggtgcaaaagacgttgaacgccag
caaccaaacgtatttagaatggagctaatgggcgcgactgtgattccggtaacagcgggt
tcaggcacattaaaagatgctgtaaacgaagcactacgtgactggtcagcaaattatcaa
gatgcgcactacctacttggtactgcagcgggcccacacccattcccaactattgtgcgt
gaataccaaaaaattattggtgaagaagcaaaacaacaagtgctaaaagctgaaggtcgc
ctacctgatgccgttattgcctgtgttggcggcggttctaatgccattggtatgtttagt
gattttattaacgagccaagtgtaaagctcattggtgttgagcctgctggtaaaggttta
gatacacacgagcacggtgccactatttgtaaaggtactaaaggtatattgcacggtact
tacacctatattatgcaaaatgacgacggccaaatagaagagtcgtattctgtatctgcc
ggccttgattacccagctgttgggccgcaacatgcatttttacacgaaacaggtcgtgca
caatatgtagccattaccgacaccgaagcactagacgcttttcagtcgcttgccaaaaat
gaaggtattattccggcgctcgaatctagccacgccctcgcttatgcacttaaatatgca
gaagcgctaactgatgaaagcattatagtggttaatttaagtggccgaggcgataaagac
ttagcccacgttcacaatgtgttgtcgcaaggaggtcaaatatga

DBGET integrated database retrieval system