KEGG   Pseudoalteromonas haloplanktis: PSHAa1290Help
Entry
PSHAa1290         CDS       T00282                                 

Gene name
trpCF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSHAa1290 (trpCF)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSHAa1290 (trpCF)
Enzymes [BR:pha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PSHAa1290 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     PSHAa1290 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1347404..1348768)
Genome map
AA seq 454 aa AA seqDB search
MANVLDKIVADKKLELIERKAARPLDSFKHLAVPTTRSFYKALAAPGIQFILECKKASPS
KGLIREPFNLTEITSVYKKYASCMSVLTDTKYFQGSFDYLEFVRSQVEQPLICKDFFIDE
YQVYMARIYGGDAILLMLSVLDDESYKALHSVADSLNMSVLTEVSNEAEVHRALALDAKI
IGINNRDLRDLSTDLATTEKLRKLIPANKVVISESGIYTHQDVKRLAPLCDGFLIGSSLM
SERDLEQACKRVILGDNKVCGLTRSQDALAAYESGAVYGGLIFHPKSPRYVDLDCAIELS
QSAPLNFVGVFVDAPIEQVAQYASVLKLAAVQLHGQESDDYITTLRTQLPSDCEIWKAQA
IKDALPTPVHGVDRILYDTHSNTQAGGTGKTFDWSVLRDATTPFMLAGGLNPENIKEALF
QGALGLDLNSGVEQSPGKKCPNKLQNAFTSIRNY
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgtattagacaaaattgttgctgataaaaaattagaactaattgagcgcaaa
gccgctcgcccactagatagctttaagcaccttgcggtgccaacaactcgcagcttttat
aaagcacttgcagcccctggcattcagtttattttagaatgtaaaaaagcatcgccgtct
aaagggcttattagagaaccttttaatttaacagaaataacctcggtttataaaaagtat
gccagctgtatgagcgtgctaaccgacaccaagtattttcaaggcagctttgattactta
gagtttgtacgtagccaagtagagcaacctcttatttgcaaagatttttttatagacgag
tatcaagtatatatggcgcgtatttatggcggcgacgctatattattaatgctctcagta
cttgacgatgaaagctataaagcattgcatagcgttgctgactcgttaaatatgtcggtg
ctaactgaggtaagtaacgaagcagaagtacaccgtgcgcttgcccttgatgctaaaata
attggcattaacaaccgagacttacgcgatttaagtacagatttagccaccaccgaaaag
ctacgtaaacttattccagctaataaagtcgttatttcggagtcgggtatttacacccac
caagacgtaaaacgattagcgccactttgcgatggctttttaattggcagctcacttatg
agcgaacgcgatttagaacaagcctgcaaaagagttatattaggcgataacaaagtatgt
ggcttaacgcgcagccaagatgcgcttgcagcgtatgaaagtggcgccgtatatggcggg
ttaatttttcaccccaagtcgcctcgttatgtcgacttagactgcgccatagagcttagc
caaagtgcaccgcttaactttgttggggtatttgtagatgcgcctatagagcaagtagcc
cagtacgcaagtgtgttaaaattggcggctgtgcaattacacggtcaagaaagtgacgat
tacattaccaccttgcgtacacaactacctagcgactgcgaaatttggaaagcacaggca
ataaaagatgcattgccgactccagtacatggtgttgatcgcattttgtacgacacccac
agcaacacccaagctggcggtacaggtaaaacatttgattggtcggtgctacgtgatgcc
accaccccctttatgcttgctggaggcttaaatcctgagaacattaaagaggcacttttt
caaggcgccttagggctagaccttaattctggagtggaacagtctccgggtaaaaagtgc
cctaacaaattacaaaacgcatttacaagtattagaaattattga

DBGET integrated database retrieval system