KEGG   Pseudoalteromonas haloplanktis: PSHAa1364Help
Entry
PSHAa1364         CDS       T00282                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSHAa1364
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSHAa1364
   00052 Galactose metabolism
    PSHAa1364
   00500 Starch and sucrose metabolism
    PSHAa1364
   00520 Amino sugar and nucleotide sugar metabolism
    PSHAa1364
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSHAa1364
   00524 Butirosin and neomycin biosynthesis
    PSHAa1364
Enzymes [BR:pha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSHAa1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1424481..1425479
Genome map
AA seq 332 aa AA seqDB search
MSLHSSAQFDPILVADIGGTNARFALITAFDAAKNEFVIEYNHTFPSADFGSLQNATRHY
LSTVPHIKPVRACLAVAGPIKAGQVHLTNLGWHFSVSEFKQAFSFLQLEVINDFAAFAYA
APYLDSNQNVVIKAGQADENSNIAVMGPGTGFGAACLVRTAQSSAVLSSEGGHISLAAVT
DLDAKLLIELRKEHPHVSLETVFSGPGIAHLYKAMAAVKGITAKHLDAAQISNLANTGEC
EVCDATLNQFCDWLGSAAGDLALAYGALGGLFIGGGILPRMQSRLLESRFVERFSQKGIM
SQYNGQVPVTLVTQDNIPLIGAAACLHNSKQE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagcttacactcttctgcccaatttgatcctattttagttgccgatattggtggtacc
aatgcgcggtttgcactaattactgcctttgatgcagcaaaaaacgaatttgttatagaa
tataatcatacctttcctagtgccgactttggctcgttacaaaatgcaacacgccattat
ttatcaactgtgcctcatattaaacctgtgcgcgcgtgtttggcggtggcaggccctata
aaagcagggcaggtgcatcttactaatttaggttggcattttagcgttagtgagtttaaa
caggctttttcttttttgcagcttgaagttattaacgattttgctgcatttgcctacgct
gccccttatttagatagtaaccaaaatgtggttattaaagcagggcaagccgatgaaaac
tcaaacattgcagttatgggcccaggcacaggatttggtgcagcttgcctagttagaaca
gcgcagtctagtgcggtgcttagctctgaaggcgggcatatatcgctggctgccgttacc
gatttagatgcaaagttacttatagaattacgcaaagaacatccgcatgtgtctttagaa
actgttttttcaggcccgggtattgcccatttatataaagcgatggcggcggttaaaggt
attactgctaagcatttagatgccgcgcaaattagtaatttagccaataccggcgagtgt
gaggtttgcgatgcaactctaaaccagttttgtgactggcttggcagtgccgcaggcgat
ttagcattagcttatggtgcgttgggcggtttatttattggcggtggtatattgccacgc
atgcaatcgcgtttgttagagagtcgttttgttgaacgtttttcacaaaaaggtattatg
tcgcaatataacgggcaagttcctgttacgctagtaacccaagataatatacctttgatt
ggcgctgcggcgtgtttgcataatagtaagcaggaataa

DBGET integrated database retrieval system