KEGG   Pseudoalteromonas haloplanktis: PSHAa1488Help
Entry
PSHAa1488         CDS       T00282                                 

Gene name
yhdH
Definition
(GenBank) putative dehydrogenase, NAD(P)-binding domain and GroES-like domain
  KO
K19745  acrylyl-CoA reductase (NADPH) [EC:1.3.1.-]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00640  Propanoate metabolism
pha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSHAa1488 (yhdH)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     PSHAa1488 (yhdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N Epimerase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAI86563
UniProt: Q3IGF9
Position
I:complement(1567006..1567998)
Genome map
AA seq 330 aa AA seqDB search
MSNPIKAIVINKDDNNYSASLSSIKNSDLPNENVTIDVLYSTLNYKDGLAITGKGPVVRS
FPMVPGIDLVGTVSHSTSDEFKSGDKVILNGFGVGEKHWGGLAQKAALNSDWLIPLPAGI
SPKQAMQVGTAGYTAMLSVIALEKQGITPDSGEVLVTGANGGVGSFAIYLLNQLGYNVTA
ATGRMEQSDYLKELGAANVINRDELSNPGKPLQKERFAAAIDSVGSHTLANICASLKYGG
VVTACGLAQGMDLPGSVAPFILRGIRLIGIDSVMRPKADRIEAWDRLASLVAADYLDKIS
TEITLEQVIDNAEQLMKGKIRGRVVVNCQS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacccaattaaagccattgttattaataaagatgataataactacagcgcctct
ttaagcagcattaagaatagtgacctgccgaatgaaaatgtcactattgatgtgctatac
agcactttaaattataaagatggcttagcaataaccggaaaagggcctgtggtacgcagt
tttcctatggtgccgggtatagatttagtaggcactgtgagccactccaccagcgatgaa
tttaaaagtggcgataaggtaattttaaatgggtttggtgtaggcgaaaaacactggggg
gggcttgctcaaaaagcagcacttaatagcgattggttaatccccttgcctgctggcatt
tcacctaaacaagctatgcaagttggcactgcgggttacaccgctatgctcagtgtaatt
gcactcgaaaaacaaggcataacacccgattcaggcgaagtgctggtaaccggtgccaat
ggtggcgtaggtagttttgcaatatatttactaaatcagcttggctacaatgtaaccgca
gctactggacgaatggagcaaagtgattatttaaaagagctaggagcagcaaatgtaatt
aatcgtgatgagctttcaaacccaggtaagccgctacaaaaagagcgttttgccgcagct
atagactcagtaggtagccatactttagctaatatttgcgcctcattaaaatatggaggt
gttgtaaccgcatgtgggcttgcacaaggtatggatttacccggctctgtagcaccattt
atattacgtggcattcgattaataggcattgatagcgtaatgcgcccaaaagccgaccga
attgaagcatgggatcgtttagcatctttagtagcagctgattaccttgataaaatatcg
actgaaataacgcttgaacaagtaattgataacgccgagcagcttatgaaaggtaaaatt
cgtggccgtgttgtagttaattgccaaagttaa

DBGET integrated database retrieval system