KEGG   Pseudoalteromonas haloplanktis: PSHAa1646Help
Entry
PSHAa1646         CDS       T00282                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSHAa1646 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSHAa1646 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSHAa1646 (sucB)
Enzymes [BR:pha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSHAa1646 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1713744..1715282)
Genome map
AA seq 512 aa AA seqDB search
MSTEIKVPVLPESVADATVATWHVSVGDKVTRDQNLVDIETDKVVLEVVAQHDGVITEIT
QEEGATVLGDQVIGLLGDADAAPASEDAPKEDSSTEESAATKSEDAPAAQSAPASEGKEV
DIKVPVLPESVADATIATWHVQAGDAVTRDQNLVDIETDKVVLEVVAQEDGIMGEIIHGE
GDTVLGEQVIGSVKAGGAPAAPAKKADAAAPAASESNDSSDVLTPSVRRLIAEKGLDAAK
IKGTGKNGRVTKEDVDTFLKAPAPAAKAAPAAAPAAAMGDRTQKRVPMTRLRKTIAKRLL
EAKNSTAMLTTFNEVNMEPIMSLRKQYQEVFEKRHGIRLGFMSFYVKAVTEALKRFPDVN
ASIDGDDIVYHNYFDISIAVSTPRGLVTPVLKDCDKLSVAEIEKGIRELALKGRDGKLTL
DDMTGGNFTITNGGVFGSLLSTPIINLPQSSILGMHKIQDRPMAVNGKVEILPMMYLALS
YDHRIIDGKESVGFLVTIKELLEDPTRLLLDV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagaaattaaagttcctgttcttcctgagtcggttgcagatgctaccgttgct
acatggcatgtaagtgttggcgacaaagtaactcgcgaccaaaacttagtagacattgaa
acagataaagtggttttagaagttgttgcgcaacatgacggtgtgattactgaaattaca
caagaagaaggcgctacggtacttggcgatcaagttatcggtttacttggcgatgctgat
gcagcaccagcaagtgaagatgcaccaaaagaagactcttcaactgaagaatctgcagca
actaaatcagaagacgcgccagcggcgcaatcagcaccagcatcagaaggtaaagaagtg
gatattaaagttcctgtacttccagaatcagttgcagacgcaacaattgctacatggcat
gtacaagcaggcgacgcagtaactcgcgatcaaaacttagtagatattgaaactgataaa
gtggtacttgaggttgttgctcaagaagacggtatcatgggtgaaataatccacggcgaa
ggcgacactgtattaggcgagcaagtaattggttcggttaaagcgggcggcgctccagca
gcaccagctaaaaaagcagacgcagctgcaccagcagcaagtgagtcaaacgacagctct
gatgtgttaacaccttcagtacgtcgtttaattgctgaaaaaggcctagacgctgcaaaa
attaaaggcacgggtaaaaacggtcgtgtaactaaagaagacgtagatactttcttaaaa
gcacctgcaccagcggcaaaagcagcaccagcggcggcacctgcagcagcaatgggcgat
cgtacacaaaaacgtgttcctatgacgcgtttacgtaaaacaattgctaagcgcttactt
gaagcgaaaaactcaactgcaatgttaacaacattcaacgaagtgaacatggaacctatc
atgagccttcgtaagcagtatcaagaagtgtttgaaaagcgccacggtattcgtttaggt
ttcatgtctttctacgtgaaagcggttactgaagcacttaagcgcttcccagatgtaaat
gcatcaattgatggtgacgatattgtttatcacaactacttcgacatcagcatcgctgta
tctacacctcgtggtctagtaacgccagtacttaaagattgtgacaagttatcagttgca
gaaatcgaaaaaggtattcgtgagctagcactaaaaggtcgtgatggtaagctaacactt
gatgatatgacgggtggtaacttcactattacaaatggcggtgtatttggttctttacta
tctactcctatcattaatttaccgcagtcttcaattttgggtatgcataaaatccaagat
cgtccaatggctgtaaacggtaaagtagaaatacttcctatgatgtatttagcactttct
tatgaccaccgcatcattgatggcaaagaatctgttggcttcttagtaacaattaaagag
ttacttgaagatccaacacgcttattactggatgtttaa

DBGET integrated database retrieval system