KEGG   Pseudoalteromonas haloplanktis: PSHAa1650Help
Entry
PSHAa1650         CDS       T00282                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSHAa1650 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSHAa1650 (sdhD)
   00650 Butanoate metabolism
    PSHAa1650 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSHAa1650 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1720694..1721041)
Genome map
AA seq 115 aa AA seqDB search
MVLNQATLKRDGVQDFVSLRTTALIISAYAIFIIGYFLATPEVTFEAWTGLFSNLAMKGF
TLIALVCIMVHTRIGLWQVLTDYVKCAKLRAVLGFVLNLMAFAYVAIGLIVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggttttaaatcaagcaactcttaaacgtgatggtgtacaagatttcgtatctttacgt
accacggcattaataataagcgcgtatgcgatttttattatcggctattttttagcaacg
ccagaagtcactttcgaagcctggacaggcctcttctctaacctagcaatgaaagggttt
actttaattgccctggtttgcattatggttcatacccgcattggcctttggcaagttcta
acagactatgttaagtgcgctaagcttcgtgctgttttaggctttgtactaaacctaatg
gcctttgcttacgtagctattggtctaatcgtattatggggtgtataa

DBGET integrated database retrieval system