KEGG   Pseudoalteromonas haloplanktis: PSHAa1860Help
Entry
PSHAa1860         CDS       T00282                                 

Gene name
phoD
Definition
alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pha00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pha00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pha02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1960875..1961918)
Genome map
AA seq 347 aa AA seqDB search
MKIITAVVLTNLLVSFSALSAPSKILFGSCGHQDKNIPIFDAINKEQSDLFIFLGDNIYG
DTNNMSVLANKYQRLGAKPGFKTLKAQTPIIAMWDDHDYGQNDAGKEYPHKEESRQIMLD
FWQEPANSPRRTRPDGIYTSYTYGEGEQTVQVIMPDLRWNRDALNAVSKLEYDTKRKLNN
QGPYSPSHVKGASMLGEAQWQWLEQELKKPAAIKLIASSLQLLPDFTGWESWANFPDDRK
RLFTLIKKHKVNGVVIISGDTHWGEISQYKHNLDYPLIEMTSSGLTEKWKNVSPNTHRIG
DFTHQVNYGDLSIDWQQADPSISLQLKDIDGKAIMQSQFKLSSISPY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataataaccgcggtagtattaaccaacttacttgtaagctttagtgctttgagt
gctccctctaaaatattatttggctcgtgcgggcatcaagataaaaacattcctatattc
gatgctataaacaaagagcagagcgatttatttatatttttaggtgacaatatttatggc
gacaccaataatatgagcgtacttgctaataaataccagcgcttaggggcaaagcccggt
tttaaaacactaaaagcgcaaacgcctattatagctatgtgggatgaccacgattatggc
caaaacgatgcaggtaaagagtatccgcataaagaagagtcgcggcaaattatgctcgat
ttttggcaagaacctgcaaactcaccacgacgcactcgccccgatggtatttatacctcg
tatacgtatggtgaaggtgagcaaactgtgcaggtgattatgccagatttgcgctggaac
cgagatgcgttaaacgcagtaagtaagttggagtacgacactaagcgcaaactaaataat
caaggcccgtatagcccaagtcatgttaaaggcgcgtcaatgcttggtgaggcgcagtgg
caatggcttgaacaagagcttaaaaagcccgcggctataaagctaattgcctcaagctta
cagctacttcccgattttacagggtgggagtcgtgggctaatttccctgacgatcgaaag
cgtttatttacactgatcaaaaagcataaagtaaacggcgtagttattattagcggcgat
acccactggggcgaaatttcacagtataagcacaaccttgactacccactaatagaaatg
accagttctggcctaaccgaaaaatggaaaaatgtaagccctaacacacaccgaataggg
gactttacccaccaggttaattacggcgatttaagcatagactggcaacaagccgacccg
tcaatttcattacagctcaaagatattgatggtaaagcaataatgcaaagtcagtttaaa
ctctcaagcattagcccttattaa

DBGET integrated database retrieval system