KEGG   Pseudoalteromonas haloplanktis: PSHAa1876Help
Entry
PSHAa1876         CDS       T00282                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSHAa1876 (ruvA)
Enzymes [BR:pha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PSHAa1876 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1978486..1979103)
Genome map
AA seq 205 aa AA seqDB search
MIGRLNGILVEKQPPEILLEVSGVGYEVQMPMTCFYDLPKVGESAIVYTHFVVREDAQLL
FGFNNKVERALFRELLKANGVGPKLGLAILSGMSAQQFVSCVNNEDSTSLVKLPGVGKKT
AERLVLEMKDRLKNWGNDLFTPFSDSAVIEPFSDATIANNAADDAVSALVSLGYKLPQAQ
KAVKSVSKPDMSTEVLIKESLKSML
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcttaaatggtattttagtagaaaaacaacctcccgaaatattattagag
gtaagtggtgttggctacgaagtgcaaatgccaatgacctgcttttatgacttacctaaa
gttggcgaaagtgccattgtttatactcattttgtagtacgcgaagatgcacaactattg
tttggctttaacaacaaagtagagcgtgccttatttagagagttattaaaggccaatggc
gtagggccaaagctaggtttagctattttgtcgggtatgtcggcgcagcaatttgtaagc
tgtgtaaataacgaagactccacaagcttagttaaattacccggtgtaggtaaaaaaacc
gccgagcggctagtactcgaaatgaaagacaggttaaaaaattggggcaacgatttattc
acccctttcagcgacagtgcggttattgagccgtttagcgacgcgacaattgctaataat
gccgccgatgatgctgtgtcggctttggtgtcgctaggttataaattgccacaagcgcaa
aaagcagtaaaatcagtaagtaaacccgatatgtctactgaagttcttattaaagaatct
ttaaaatcaatgctgtga

DBGET integrated database retrieval system