KEGG   Pseudoalteromonas haloplanktis: PSHAa2142Help
Entry
PSHAa2142         CDS       T00282                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PSHAa2142 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSHAa2142 (mhpF)
   00650 Butanoate metabolism
    PSHAa2142 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSHAa2142 (mhpF)
   00622 Xylene degradation
    PSHAa2142 (mhpF)
   00621 Dioxin degradation
    PSHAa2142 (mhpF)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PSHAa2142 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     PSHAa2142 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2268800..2269702
Genome map
AA seq 300 aa AA seqDB search
MKKIKCALIGSGNIGTDLLYKLKRSEILEPVWMVGIDPDSEGLARARELGIKTTADGIDG
LIPHIEADEIKIAFDATSAYVHGENSAKVNAKGVLMIDLTPAAIGPFCVPPVNLNQLNAD
IKNVNMVTCGGQATIPMVAAVSRVQPVEYGEIVATVSSKSVGPGTRQNIDEFTRTTSGAV
EQIGGAKKGKAIIIINPAEPPLLMRDTIHCLTETEPDQAAITASVHEMIAEVQKYVPGYK
LKNGPVFDGRKVSIFLEVEGLGDYLPKYAGNLDIMTASAARTAEMFALQMLGQSPSDSQS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattaaatgcgccctgatcggttcaggaaacattggtactgacttactttat
aagctcaaacgcagtgagatattagaacccgtttggatggtaggcatagaccctgactca
gaaggcttagcgcgcgcacgcgaattgggtattaaaaccaccgccgacggtatcgatggc
ttaataccgcatattgaagccgatgaaatcaaaattgcttttgatgcaacctcagcctac
gtgcatggtgaaaactcagctaaagtgaatgcaaaaggcgtgttgatgatagatttaacc
ccagcggctattggccctttttgtgtgcctccggttaacctaaatcaacttaatgctgat
attaaaaacgttaacatggtgacctgtggcggccaagcaactattcctatggttgctgcg
gtatcgcgcgtacagccggttgaatatggtgaaattgttgccactgtttcatcaaaatca
gttggcccaggtacacgccaaaatattgatgaatttactcgcactacctcaggcgcagtg
gagcaaattggtggcgctaaaaaaggcaaagccattattataattaaccctgctgagcca
ccattattaatgcgcgacaccatccattgcttaaccgaaacagagccagatcaagcagct
atcactgcatctgtgcatgaaatgattgctgaagtacaaaagtatgttccaggctataaa
ctaaaaaatggcccggtgtttgatggtcgtaaagtgtctatatttttagaggttgaaggt
ttgggcgattacttgcctaaatatgccggtaaccttgacataatgaccgcgtcggccgcg
cgtactgcagaaatgtttgcactacaaatgctaggtcaatcgccatcagatagtcaatct
taa

DBGET integrated database retrieval system