KEGG   Pseudoalteromonas haloplanktis: PSHAa2164Help
Entry
PSHAa2164         CDS       T00282                                 

Gene name
bcsZ
Definition
(GenBank) Endoglucanase precursor (Endo-1,4-beta-glucanase) (Cellulase) (Carboxymethylcellulase) (CMCase) (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
pha  Pseudoalteromonas haloplanktis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:2294446..2295576
Genome map
AA seq 376 aa AA seqDB search
MKLFITKAFIMLILFTPLSHAQQCAPWQQWQTFKTHFMSDDGRIIDLGSEQNITTSEGQS
YALFFALIANDKTAFDKVLNWTEEHLAEGDLSTRLPAWLWGVNKNNVGNILDSNPASDSD
LWIAYSLSQAAILWDDRRYRILAAVLAQRIMREETAYIKGLGLSLLPAPSGFEFDNKRYK
LNPSYSPLFIYQQFSKLYPHSPWQELHDGSANLILETSKQGVSPDWIMFDTNKGFYFDKK
VTDLGSYNAIRVYLWASMMAEDAPYKKQLVTQFAPFIKTINKRGYVPLNTYAQTGNSDKR
GPVGFNAALLPLLATANNDNDAVTMSIQQKLMVDKSFSKSRYYDSVLNLFGSSTLDKRFA
ILADGTLQPNWSDECR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttataactaaagcatttattatgctgattttatttactcctttaagccac
gcacaacaatgtgcgccttggcagcaatggcaaacgtttaaaacacactttatgagtgat
gatggccgaataatcgacttaggcagcgagcaaaatattaccacttctgaagggcaatcc
tatgcgctattttttgcgctaattgccaatgataaaaccgcttttgataaagtattaaac
tggactgaagagcatttagccgaaggcgatttaagtactcgcctacctgcatggctatgg
ggagttaataaaaacaacgtaggtaatattcttgactcaaacccagcatctgactctgat
ttatggattgcttatagcttatcgcaagcagctatactttgggatgaccgccgttaccgt
attttagcagctgtgctcgcacagcgtataatgcgcgaagaaacagcgtatattaaagga
cttggtttatctttattacccgcacctagcggctttgagtttgataacaagcgctataaa
ttaaatccaagctattcgccgctgtttatttatcagcaatttagcaaactttatcctcat
tcaccatggcaagagctgcatgacggttctgccaacctaattcttgaaacaagtaagcaa
ggtgttagccctgattggattatgtttgatactaacaagggcttttactttgataaaaaa
gtaaccgacttgggaagctataatgcaattagagtctatttgtgggcaagtatgatggca
gaggatgcaccttacaaaaagcaattagttacgcagtttgctcctttcattaaaaccata
aataagcgtggttatgtgcctttaaatacctatgcacaaacggggaactcagataaaaga
ggacctgttggctttaatgccgcattactgcctttactagcaacagcaaataatgacaat
gacgctgtaacaatgtcgattcaacaaaagttaatggttgataaatcatttagcaaatcg
cgttattacgatagtgtattaaatttatttggtagcagtaccttagataaacgctttgca
attttagcagacgggacgctgcaacctaactggagcgatgaatgtcgttaa

DBGET integrated database retrieval system